KEGG   Serratia plymuthica 4Rx13: SOD_c46780Help
Entry
SOD_c46780        CDS       T02710                                 

Gene name
yihX
Definition
(GenBank) alpha-D-glucose-1-phosphate phosphatase YihX
  KO
K20866  
glucose-1-phosphatase [EC:3.1.3.10]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Glycolysis / Gluconeogenesis
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOD_c46780 (yihX)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SOD_c46780 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5255087..5255677)
Genome map
AA seq 196 aa AA seqDB search
MLYIFDLGNVIVDIDFKRVLGVWSNLSGTPLAVLSERFTLGELFQQHERGEISDEDFAER
LSDEMGIALSFEQFATGWQAVFVALRPEVIDIMKRLRSEGHRVVVLSNTNRLHCNYWPQH
YPEVAEAADHLYLSQDIGMRKPDANIYLHVLNAENTPPEAAVFFDDHPDNVAAAQALGIK
TVHVTDRNVVPAYFAQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatatctttgatttaggtaatgtgattgtcgatatcgatttcaaacgtgtactg
ggtgtatggagcaatttgagtggcacgccgctggcggtattgtctgagcgtttcaccctg
ggtgagttgttccagcagcatgagcgaggtgaaatcagcgacgaagattttgccgaacgg
ctaagtgatgaaatgggtatcgccctcagttttgagcagttcgctaccggctggcaggcg
gtgtttgtcgccctgcgtccggaggtgatcgatatcatgaagcgcctgcgcagcgaaggt
caccgggtggtggtgttgtcgaacaccaatcgtctgcactgcaactattggccgcagcat
tatccggaagtggccgaggccgccgatcatctgtatctgtctcaggacatcggtatgcgc
aaaccggacgccaacatctatctgcacgtactcaacgccgaaaatacgccgccggaagcc
gcagtgttcttcgacgatcatccggataacgtcgccgccgcacaggcgctgggaatcaaa
acggtgcacgtgaccgaccgtaacgtggtgcctgcttattttgcccaatga

DBGET integrated database retrieval system