KEGG   Serratia plymuthica 4Rx13: SOD_c46790Help
Entry
SOD_c46790        CDS       T02710                                 

Gene name
typA
Definition
(GenBank) GTp-binding protein TypA/BipA
  KO
K06207  
GTP-binding protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5255841..5257652)
Genome map
AA seq 603 aa AA seqDB search
MRNIAIIAHVDHGKTTLVDKLLQQSGTFGERVEATERVMDSNDLEKERGITILAKNTAIN
WKDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAMDGPMPQTRFVTKKAFANGLKPI
VVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPIIYASALMGIAGTDHNEMAEDMT
PLYQAIVDHVSAPQVELEAPFQMQISQLDYNNYVGVIGIGRIKRGKVKPNQQITIIDSEG
KTRNGKVAKVLTHMGLERIEAAVAEAGDIIAITGLGELNISDTICDTNAVEALPALSVDE
PTVTMYFNVNTSPFCGKEGKYVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGEL
HLSVLIENMRREGFELAVSRPKVINRKIDGRMQEPFENVTLDIEEQHQGSVMQAMGERKG
DVKDMIPDGKGRIRLDYLIPARGLIGFRTEFMTMTSGTGLLYSTFSHYDDVRQGEIGQRQ
NGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLT
NMRASGTDEATTLVPAIKMSLEQALEFIDDDELVEVTPTSVRIRKRHLTENDRKRASRGP
KDA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtaacatcgccattattgcccacgttgaccatggtaaaaccaccctggttgataag
ctgctgcaacaatccggtactttcggagagcgtgtagaagccaccgaacgcgtaatggac
tccaacgatttggagaaagagcgtgggattaccatcctcgcaaaaaacaccgccattaat
tggaaagactaccgcatcaacatcgtggataccccaggacacgccgacttcggcggcgag
gttgagcgtgtgatgtcaatggttgactcggtgctgctggttgtggatgcaatggatggc
ccaatgccgcaaacccgcttcgtgaccaaaaaagccttcgctaatggtctgaagccgatc
gtggtaatcaacaaggttgaccgtccgggcgcacgtcctgactgggttgtcgatcaggtc
ttcgacctgttcgttaacctcgacgcgaccgatgagcagctcgacttcccaatcatctat
gcttctgcattgatgggtatcgcgggcaccgaccacaacgagatggcggaagacatgacc
ccgctgtatcaggcgatcgtagaccacgtgtctgcgccgcaggttgagctcgaagcgccg
ttccagatgcagatctctcagctggactacaacaactacgttggcgttatcggtatcggc
cgtatcaagcgcggtaaggttaaacctaaccagcagatcactatcattgatagcgaaggc
aaaacccgtaacggtaaagtcgctaaggttctgacccacatgggtctggaacgtatcgaa
gctgccgtggctgaagctggcgacatcatcgctatcaccggtctgggcgagttgaacatc
tctgacaccatctgcgacaccaacgctgttgaagcgctgccggcgctgtctgttgatgaa
cctaccgtcaccatgtacttcaacgtcaacacctctccgttctgcggtaaagaaggcaag
tacgtgacttcacgtcagatcctcgaccgtctgaacaaagagctggtgcacaacgtggca
ctgcgcgttgaagaaaccgaagatgctgacgcattccgcgtatcgggccgtggtgaactt
cacctgtcggttctgatcgaaaacatgcgtcgcgaaggtttcgagctggcggtttcccgt
cctaaagttatcaaccgtaaaatcgatggccgcatgcaagagccgttcgagaacgtgacg
ctggatatcgaagaacagcaccagggttcagtcatgcaagccatgggtgagcgcaaaggt
gacgttaaggacatgatcccagacggcaaaggtcgtattcgcctggattacctgatccct
gcgcgtggcctgatcggcttccgtaccgagttcatgaccatgacttccggtaccggtctg
ctgtactccaccttcagccactacgacgatgtacgccagggcgaaatcggccagcgtcag
aacggcgtgctgatctccaacggccagggtaaagcggtagcgttcgccctgttcggcctg
caagatcgcggcaagctgttcctgggtcacggtgcggaagtgtatgaaggccagatcatc
ggcattcactcacgttccaacgacctgaccgtaaactgcctgaccggtaagaagctgacc
aacatgcgtgcttccggtactgacgaagccactactctggttccggctatcaagatgtct
ctggagcaagctctggaattcatcgatgatgacgaactggtagaagtaacgccaacgtcc
gtacgtattcgtaaacgtcacctgacggaaaacgatcgtaagcgtgcaagccgcggtcct
aaagacgcttaa

DBGET integrated database retrieval system