KEGG   Serratia plymuthica 4Rx13: SOD_c46880Help
Entry
SOD_c46880        CDS       T02710                                 

Gene name
dsbA
Definition
(GenBank) thiol:disulfide interchange protein DsbA
  KO
K03673  
thiol:disulfide interchange protein DsbA
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Module
Cationic antimicrobial peptide (CAMP) resistance, envelope protein folding and degrading  factors DegP and DsbA
Brite
KEGG Orthology (KO) [BR:srl00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SOD_c46880 (dsbA)
Chaperones and folding catalysts [BR:srl03110]
 Protein folding catalysts
  Protein disulfide isomerase
   SOD_c46880 (dsbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5270639..5271262)
Genome map
AA seq 207 aa AA seqDB search
MKKIWLALVGMVMAFSASAAQFSDGSQYVTLDKPVTGEPQVLEFFSFYCPHCYQFEQVYH
VSENVKKALPAGTKMTKYHVEFLGPLGKQLTQAWAVAMALGVEDKVSPLMFEAVQKTQTV
QTPDDIRNVFVKAGVSAEDYDAAWNSFVVKSLVVQQEKAAEDLQLRGVPAVFVNGKFMVK
NDGLDTSSMDAYVKQFADVVKFLSQQK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatatggttggcgctcgttggcatggtaatggcattcagtgcctcggctgcg
cagtttagcgatggttctcagtatgtaaccctggacaaaccggtgaccggtgaacctcag
gtgctggagttcttttccttctattgcccgcactgctatcagttcgagcaggtttaccac
gtttccgagaacgtgaaaaaagcgctgcctgcaggcaccaaaatgaccaaataccacgtt
gagtttctggggccgctgggtaaacagctgactcaggcctgggcggttgcgatggcgctg
ggtgtggaagataaagtgagcccgctgatgtttgaagccgtacaaaaaactcagaccgtg
caaacccctgatgatatccgtaacgtgtttgtcaaagccggcgtgagtgcggaagactac
gatgcggcctggaacagctttgtggtgaaatccctggtggttcaacaggagaaagctgcg
gaagatctgcagctgcgcggtgttccggcagtatttgtgaacggtaagtttatggttaaa
aatgatggcctggacaccagctcgatggatgcttacgtgaagcaattcgccgacgtggtt
aaattcctcagccagcagaaataa

DBGET integrated database retrieval system