KEGG   Serratia plymuthica 4Rx13: SOD_c46910Help
Entry
SOD_c46910        CDS       T02710                                 

Gene name
mobA
Definition
(GenBank) molybdenum cofactor guanylyltransferase MobA
  KO
K03752  
molybdenum cofactor guanylyltransferase [EC:2.7.7.77]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SOD_c46910 (mobA)
Enzymes [BR:srl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.77  molybdenum cofactor guanylyltransferase
     SOD_c46910 (mobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5272803..5273396
Genome map
AA seq 197 aa AA seqDB search
MHEDITGIILAGGRATRMGGEDKGLVQVAGIPMYQHVLARLQPQVGSIAISANRNQARYQ
ESGLPTIGDLTTDFSGPLAGILAGLKYAATEWVVFVPCDVPDFPTTLVEQLWQQKGPALA
AYASDGERAHPTLALLHTSLVPQLAGYLARGDRKLMLFLDAAGARQVTFIGQQAAFNNLN
TREDCLRWQQEKGFPHE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggacattaccggcattattctggccgggggacgcgccacgcgaatgggtggg
gaagataaaggcttggttcaggttgccggaataccgatgtatcagcacgtgcttgcccga
ttacaaccgcaggtaggctcgattgccatcagcgccaaccgcaatcaggcccgttatcag
gaaagcggcctgccgacgatcggcgatctgaccactgacttttccggtcctctggccggt
atattggccgggctgaaatacgccgccactgaatgggtggtatttgttccctgcgatgtg
cccgattttcccaccacgttggtcgaacaactctggcagcaaaaaggcccggctctggcc
gcctatgccagcgatggggagcgggcacatccaacgctggcactgttgcacaccagcttg
gtgccccagttagcaggctatctggctagaggggatcgcaagctaatgctgtttctggac
gctgcaggcgcgcgccaggtaacgttcattggtcagcaagccgcattcaacaaccttaat
acgcgagaagactgcctgcgctggcagcaggaaaaaggattcccccatgaataa

DBGET integrated database retrieval system