KEGG   Serratia plymuthica 4Rx13: SOD_c47010Help
Entry
SOD_c47010        CDS       T02710                                 

Gene name
rbsB
Definition
(GenBank) D-ribose-binding periplasmic protein RbsB
  KO
K10439  
ribose transport system substrate-binding protein
Organism
srl  Serratia plymuthica 4Rx13
Pathway
ABC transporters
Bacterial chemotaxis
Module
Ribose transport system
Brite
KEGG Orthology (KO) [BR:srl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SOD_c47010 (rbsB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SOD_c47010 (rbsB)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    SOD_c47010 (rbsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5283957..5284847)
Genome map
AA seq 296 aa AA seqDB search
MMKMKKLAILASAFALTATLSANALAKDTIALVVSTLNNPFFVSMKEGAQQEANKLGYNL
VVLDSQNNPAKELANVQDLMVQAPKLLLINPTDSDAVGNAIKMANQAKIPVITLDRVASK
GEVVSHIASDNRVGGKMAGDFIAKKVGTDAKVIQLEGIAGTSAARERGEGFKQSLDQNKF
KLLASQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEMALGALRALQTAGKTDVVVVGF
DGTADGVKAVEGGKLAATVAQRPDQIGVIGVETADKVLKGEKVPATLPVDLKLVTK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgaaaaaactggcaatcctggcttcggccttcgctctgaccgccacctta
agcgctaacgcgttggcgaaagacaccatcgcgctggtggtgtccaccctgaataacccg
ttcttcgtttccatgaaagaaggcgcgcagcaggaagccaacaagttgggttataacctg
gtggtgctggactcgcagaacaacccggcgaaagagctggctaacgtgcaggatctgatg
gtgcaagcgcctaaactgctgctgattaacccaacggattccgatgcggtgggtaacgcc
atcaagatggccaatcaggccaagatcccggtcattacgctggaccgcgtggcaagcaag
ggcgaggtggtcagccatatcgcctcggacaaccgcgttggcggcaaaatggccggcgac
tttatcgctaaaaaagtaggcacagacgctaaagtgatccagctggaagggattgcgggc
acctctgccgcccgtgagcgtggcgaagggttcaaacagtcgcttgatcagaacaaattc
aaactgctggccagccagccggcagatttcgaccgcaccaagggcctgaacgtaatgcaa
aacctgctgactgctcacccggacgtgcaggcagtgtttgcgcagaacgacgaaatggcg
ctgggcgcactgcgcgcgctgcaaaccgccggtaaaaccgatgtggtcgtggtaggcttc
gacggcaccgccgacggcgtgaaagcggttgaaggcggcaagttggcggcgaccgtggcg
cagcgtccggatcaaatcggcgtgattggcgtggaaacggcagataaggtcttgaaaggc
gagaaagtaccggccaccctcccggttgatttgaaactggtcactaaataa

DBGET integrated database retrieval system