KEGG   Serratia plymuthica 4Rx13: SOD_c47020Help
Entry
SOD_c47020        CDS       T02710                                 

Gene name
rbsC
Definition
(GenBank) ribose transport system permease protein RbsC
  KO
K10440  
ribose transport system permease protein
Organism
srl  Serratia plymuthica 4Rx13
Pathway
ABC transporters
Module
Ribose transport system
Brite
KEGG Orthology (KO) [BR:srl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SOD_c47020 (rbsC)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    SOD_c47020 (rbsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5284868..5285833)
Genome map
AA seq 321 aa AA seqDB search
MSSQSVAKRWFSKEWLLEQKSLIALLVLIAVVSSMSPNFFTLNNLFNILQQTSVNAIMAV
GMTLVILTSGIDLSVGSLLALTGAVAASIVGFEINAVVAVAAALALGAAVGACTGVIVAK
GKVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFTDVADTFGWFGIGRPLGVPTPIWIMAI
VFIAAWYMLHHTRLGRYIYALGGNEAATRLSGISVDKVKIIVYSLCGLLAALAGVIEVAR
LSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSYY
QMIVKAVVILLAVLVDNKSNK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccagagtgtcgcaaagcgctggttcagtaaagagtggctgttagagcaaaag
tccctgattgctctgctggtgctgattgccgtggtctcttcaatgagcccgaatttcttc
accctgaacaacctgttcaatattctccagcaaacgtcggtgaacgccattatggcggtc
gggatgacgctggtgatcctgacttccggtatcgatctgtcggtgggatcgctgctggcg
ctgaccggtgcggtggcggcgtcgatcgtcggttttgaaattaacgcggtggtggccgtt
gcggcggcgctggcgttgggtgctgcggtgggtgcctgcaccggcgtgattgtcgccaaa
ggcaaggtgcaggcatttattgccaccctggtgatgatgttgctgctgcgcggcgtcacc
atggtgtacaccaacggcagcccggtgaataccggctttaccgacgtggccgataccttc
ggttggttcggcatcggccgcccgctgggggtgccaaccccgatctggatcatggcgata
gtgtttatcgccgcctggtacatgctgcaccacacccgtctgggccgctatatttatgcc
ctgggcggtaacgaagcggcgacccgcctttccggcatcagcgtcgataaagtgaagatt
atcgtttattcactgtgcgggctgctggcggcgctggctggcgttatcgaagtggcgcgt
ttgtcttctgcgcagccgactgccggtaccggctatgagttggatgccatcgccgccgtc
gtgctgggtggcaccagcctggcgggcggcaaaggccgcatcgtaggcacgctgatcggg
gcgttgatcctcggcttcctgaacaacggcctgaatttactgggtgtttcttcctactac
caaatgatcgtgaaggcagtggtgatactgctggcggttctggtagataacaaaagcaac
aagtaa

DBGET integrated database retrieval system