KEGG   Serratia plymuthica 4Rx13: SOD_c47090Help
Entry
SOD_c47090        CDS       T02710                                 

Gene name
asnC
Definition
(GenBank) regulatory protein AsnC
  KO
K03718  
Lrp/AsnC family transcriptional regulator, regulator for asnA, asnC and gidA
Organism
srl  Serratia plymuthica 4Rx13
Brite
Transcription factors [BR:srl03000]
 Prokaryotic Type
  Helix-turn-helix
   Lrp/AsnC family
    SOD_c47090 (asnC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5294219..5294680
Genome map
AA seq 153 aa AA seqDB search
MAENYQIDNLDRGILNALMENARTPYAELAKNFAVSPGTIHVRVEKMKQAGIITGARVDV
NPKRLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTGHYSVFIKVMCRSIDAL
QQVLINKIQTIDEIQSTETLISLQNPIMRTITP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaattaccagatcgataatctcgatcgcggcattctcaacgccctgatggag
aatgcgcgcacgccctatgccgaactggcgaagaactttgccgtcagtcccggcaccatc
catgtgcgggtagagaaaatgaagcaggccggtatcatcaccggcgcacgggtagacgtg
aaccccaaacgcctgggttacgacgtctgctgttttatcggcattatattaaagagtgcc
aaagactatccttccgcgcttaaaaaactcgaaagcctggaggaagtggtcgaagcctac
tacaccactggccactacagcgtgtttatcaaagtgatgtgtcgctcgatagatgcattg
caacaagtacttatcaacaagatccagacgattgacgagatccagtccaccgaaaccctg
atctcgctgcagaaccccatcatgcgtaccatcacgccttag

DBGET integrated database retrieval system