KEGG   Serratia plymuthica 4Rx13: SOD_c47100Help
Entry
SOD_c47100        CDS       T02710                                 

Gene name
mioC
Definition
(GenBank) protein MioC
  KO
K06205  
MioC protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5294777..5295217
Genome map
AA seq 146 aa AA seqDB search
MADITLISGSTLGSAEYVAEHLAEKLEEAGFTTEMLHGPELDELTLSGRWLVVSSTHGAG
DLPDNLQPLLEQIEEQQPDLSQVQFGAVGLGSSEYDTFCGAIQRINDLLIACGAKRIGDR
LEIDVTKHEIPEDPAEEWVKNWVNLL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcagatataaccctgatcagtggcagtacacttggcagcgccgagtatgtagccgaa
catttggctgaaaagctggaagaggcaggcttcactaccgagatgctgcacggtcctgaa
ttggatgaactgaccctgtccgggcgttggctggtggtgtcttcaacccacggcgccggc
gacttgccggataatctgcagccgcttctggaacaaatagaagaacagcagcctgacttg
tcgcaggtgcagttcggtgccgtcggtttaggcagctctgaatacgataccttttgcggc
gcgatccaacggatcaacgatcttttgatcgcctgtggagcgaaaaggatcggcgatcgg
ttggagatcgacgtgactaaacacgaaattcctgaggatccggcagaggaatgggtgaaa
aactgggttaatttactctga

DBGET integrated database retrieval system