KEGG   Serratia plymuthica 4Rx13: SOD_c47120Help
Entry
SOD_c47120        CDS       T02710                                 

Gene name
rsmG
Definition
(GenBank) ribosomal RNA small subunit methyltransferase G
  KO
K03501  
16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170]
Organism
srl  Serratia plymuthica 4Rx13
Brite
Enzymes [BR:srl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.170  16S rRNA (guanine527-N7)-methyltransferase
     SOD_c47120 (rsmG)
Ribosome biogenesis [BR:srl03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    SOD_c47120 (rsmG)
Chromosome [BR:srl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SOD_c47120 (rsmG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5297626..5298246
Genome map
AA seq 206 aa AA seqDB search
MQKKLDSLLSAAGIALPDQQKQQLLGYVGMLDKWNKAYNLTSVRDPQQMLVRHILDSIVV
NPHLQGSRFIDVGTGPGLPGIPLAIVRPDSHFTLLDSLGKRVRFLRQVQHELGLTNIEPV
QSRVEEFPAEPPFDGVISRAFASLQDMLSWCHHLPAKGQGRFYALKGVRPDEELAQLPEG
IVLESVVRLQVPELEGERHLVVLKAN
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaattagattcgctgctctcggcggcaggcattgcgcttcccgatcagcaa
aaacagcagttgctgggttatgtcggcatgctggataagtggaacaaagcttacaacctc
acttccgtgcgcgatccgcagcaaatgctggtgcgtcatattctcgacagcatcgtggtg
aacccgcatctacaaggctcacgttttatcgacgtcggcacagggcctggtctgccgggt
atcccattggctatcgttcgtcctgattctcatttcaccctgctcgacagtctgggaaag
cgagtgcgcttcctgcgccaggtgcagcatgagctgggattgaccaatatcgagccggtg
cagagccgtgttgaagagttcccggccgaaccgccttttgacggcgtcatcagccgcgct
ttcgcttcgctgcaggatatgctgtcctggtgccatcatctgcctgcaaaagggcagggg
aggttctacgcgctgaaaggggtacgcccggatgaagagctggcgcaactgcctgaaggc
atagtgctggagtcggtggtgcgtctgcaggtaccggaactcgaaggtgaacgccatttg
gtggtacttaaggcaaactga

DBGET integrated database retrieval system