KEGG   Serratia plymuthica 4Rx13: SOD_c47170Help
Entry
SOD_c47170        CDS       T02710                                 

Gene name
atpH
Definition
(GenBank) ATP synthase subunit delta
  KO
K02113  
F-type H+-transporting ATPase subunit delta
Organism
srl  Serratia plymuthica 4Rx13
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    SOD_c47170 (atpH)
Photosynthesis proteins [BR:srl00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SOD_c47170 (atpH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5300900..5301433
Genome map
AA seq 177 aa AA seqDB search
MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAVATRNEQISELLSGAVAPETLSKT
FIAVCGEQLDEHGQNFIRVMAENGRLLVLPAVLQQFIELRALLESTVEVEVLSASVLNDE
QQAKIAAAMEKRLSRKVKLNCKIDKSVLAGVIIRAGDMVIDGSVRGRLERLTDVLQS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatttgtaactgtagctcgcccctacgccaaagcagcttttgactttgccgtt
gagcaccaaagcgtagaacgctggcaggatatgctggcgtttgccgctgttgccactcgc
aatgaacaaatttctgaactgctgtctggtgctgtcgcgccggagacgctgtccaaaacg
ttcatcgctgtttgtggcgagcagctcgacgaacatggccagaactttatccgtgtaatg
gccgaaaatggacgtttactggttcttcccgcggtgctgcagcagttcatcgaactgcgc
gctttgctggaatccaccgtcgaagtcgaagtgctctctgcgagcgtacttaacgacgaa
cagcaggctaaaattgccgctgcgatggaaaaacgtctgtcacgcaaagttaagctgaat
tgcaaaattgacaagtctgttctggctggcgtgattatccgcgccggcgatatggtgatt
gatggcagcgttcgcggtcgtcttgaacgcctgacagacgtcttgcagtcttaa

DBGET integrated database retrieval system