KEGG   Serratia plymuthica 4Rx13: SOD_c47240Help
Entry
SOD_c47240        CDS       T02710                                 

Definition
(GenBank) hypothetical protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5309475..5309855)
Genome map
AA seq 126 aa AA seqDB search
MKKILILSTVSLGLLAMANATAADGLQRSKQSSGSTDNILLWSHYDQGYIISNYELGDLD
GFKEQLRLQEQVIKKLQDKLSNMENENRNQNSEIDNLKRKLQGQDNAQSEISDLKRSVQD
LNNKIK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatacttatattgtcaacggttagccttggtttgctggctatggccaacgcc
acggcggcggatggactacagcgcagcaagcagtcgagcggcagtaccgataacatcctt
ctttggagccattacgaccaaggctacatcatttccaattatgagcttggagatttagac
ggcttcaaagaacaattaaggcttcaggaacaggtcatcaagaaactgcaagacaagctt
agcaatatggaaaacgagaaccgaaatcaaaacagcgagatcgacaatctgaaacgtaag
ttacaagggcaagacaatgcccaaagcgaaatcagcgatctgaaacgctcggtacaagac
ctgaataacaaaattaaatga

DBGET integrated database retrieval system