KEGG   Serratia plymuthica 4Rx13: SOD_c47250Help
Entry
SOD_c47250        CDS       T02710                                 

Gene name
pstS
Definition
(GenBank) phosphate-binding protein PstS
  KO
K02040  
phosphate transport system substrate-binding protein
Organism
srl  Serratia plymuthica 4Rx13
Pathway
ABC transporters
Two-component system
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:srl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SOD_c47250 (pstS)
  Signal transduction
   02020 Two-component system
    SOD_c47250 (pstS)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    SOD_c47250 (pstS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5310073..5311113
Genome map
AA seq 346 aa AA seqDB search
MKLMRTTVASIVAATFSLTAVSAFAAASLTGAGATFPAPVYAKWADSYQKETGNKVNYQG
IGSSGGVKQIIANTVDFGASDAPLSDDKLAADGLFQFPTVIGGVVLAVNIPGIKSGELTL
DGKTLGDIYLGNVKKWNDPAITKLNPGVKLPDQNIAVVRRADGSGTSFVFTSYLSKANAQ
WKEKIGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGK
PVSPTEESFSAAAKGVDWSKTFAQDLTNQKGDGAWPITSTTFILVHKEQKNPAQGAEVLK
FFDWAYKTGAKQANDLDYASLPNEVVEQVRAAWKTNVKDSSGKALY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatgcgtaccaccgtcgccagtattgtggcagcgactttctccctgaccgcc
gtgtccgcgttcgctgctgccagcctgaccggtgcaggtgcgacattccccgctccggtg
tatgccaagtgggcagattcttatcagaaagaaaccggcaacaaggttaactatcagggg
atcggttcctctggcggcgtgaagcaaatcattgccaacaccgttgactttggtgcttct
gatgccccgttgtctgacgacaaactggcggccgatggcctgttccaattccctaccgtg
atcggcggcgtagtgctggccgtaaacatcccgggcatcaaatccggtgaattgaccctg
gacggtaaaacgctgggtgacatctacctgggcaacgtgaagaaatggaatgacccggca
atcaccaagctgaacccgggcgtcaagctgccggatcagaatatcgccgtggtacgccgc
gctgacggttcaggcacctctttcgtgttcaccagctacctgtctaaagccaacgcgcag
tggaaagagaaaatcggcgcaggctctaccgttaactggccaaccggtctgggcggcaaa
ggcaacgacggcatcgccgcgttcgtacagcgtctgccaggctctatcggctacgttgag
tacgcttacgccaagcaaaacaacctggcttacaccaagctgatttctgccgacggcaag
ccggtcagcccaaccgaagagagcttcagcgccgccgctaaaggcgtggactggagcaaa
actttcgctcaggacctgactaaccagaaaggcgatggcgcatggccaatcacctccacc
accttcatcctggtgcacaaagagcagaaaaacccggctcagggcgcagaagtgctgaag
ttctttgactgggcgtacaaaaccggcgccaagcaggccaacgatctggattacgcctct
ctgcctaacgaagtggttgagcaggtgcgtgcagcatggaaaaccaacgtaaaagacagt
tccggtaaagcactgtactaa

DBGET integrated database retrieval system