KEGG   Salinibacter ruber M8: SRM_00029Help
Entry
SRM_00029         CDS       T01209                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
srm  Salinibacter ruber M8
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SRM_00029 (gmk)
Enzymes [BR:srm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SRM_00029 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(29163..29801)
Genome map
AA seq 212 aa AA seqDB search
MGAERFARRYAPPSPLHTLPLNATMPDRNIVVLTAPSGAGKTTIAHRVLEAMPDMQFSVS
ATTRAARPDETDGVDYHFLSPEEFRARIDAGDLLEYEEVYPDQFYGTLRSEVEDRANDGP
VLLDIDVKGALNVKRIFGDDALVLFVAPPSLDELRRRLEGRGTEDRESLQDRLDRVEQEM
DRADDCDAVVVNDDLDPAVEETLTRIRQFLGL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgctgagcgttttgcgcgccggtacgccccaccctcacccctgcacactctcccc
ctcaacgccaccatgcccgaccgcaacatcgtcgtactgacggccccgagcggcgccggc
aagaccaccattgcccatcgggtactggaggcgatgccggacatgcagttttccgtatcg
gccacgacgcgtgccgcccgccccgacgagacggacggggtggactaccactttctctcc
cccgaggaatttcgcgcccggatcgatgccggcgacctgctcgagtacgaagaggtgtac
cccgatcagttttacgggacgctccgctcggaggtcgaagaccgggccaacgacgggcct
gtgctgctcgacattgacgtgaaaggggcgctcaacgtcaagcgcattttcggggacgac
gccctcgtactattcgtggcccctccgtccctcgacgagttgcggcgccggctcgaagga
cgtggcaccgaggaccgtgagtcgcttcaggaccgcctcgaccgggtcgagcaggaaatg
gatcgggccgacgactgcgatgcggtggtcgtgaatgatgacctggaccctgcggtcgag
gaaaccctcacccgaattcgtcagtttctaggtttatga

DBGET integrated database retrieval system