KEGG   Salinibacter ruber M8: SRM_00215Help
Entry
SRM_00215         CDS       T01209                                 

Gene name
asnB
Definition
(GenBank) Asparagine synthetase B [glutamine-hydrolyzing]
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
srm  Salinibacter ruber M8
Pathway
srm00250  Alanine, aspartate and glutamate metabolism
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SRM_00215 (asnB)
Enzymes [BR:srm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SRM_00215 (asnB)
Peptidases [BR:srm01002]
 Cysteine Peptidases
  Family C44
   SRM_00215 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 RP-C
Motif
Other DBs
NCBI-ProteinID: CBH23136
UniProt: D5H531
Position
262603..264672
Genome map
AA seq 689 aa AA seqDB search
MSGISGIVSRSRNPSIRAHIDMMTRSLDHRGPDGSGVWVNEARNVALGHVLLATTPESKA
ERQPLSDMPGGVALTADLRIDNRESIHRSLRLESSPSDPLTSPKLLARAYRKWGAECTDH
LFGDYAYAIWDGQSGHLLCVRDPMGVKPLYYVRTDSIFAFASEIRSLLTLPGVSDQINRR
QVLTFLSGGYTPREETFFESIKCLEPGHLMHVFPDLSTSSERYWSPARQIEKLSLRKDSE
YERKFRKVLEQAVGANLRSIGEVGILLSGGMDSSSVASVADAHERSSSAPLHTFSYTFPS
LTERKRRFVDEREYIDAVLESGEFDPHFLDAGTLSPLHQLEDMVEVWGQPFNIRGLYTVS
KILENARGNGVRVLLDGAEGDSVIGYGYDLLTQLGREDDWERFAEIARQHSENYQEGRRK
YPPEKVFWNHGFGVIVEHLRRGRLRRFYRSANAVSKHLGIPRYLILKRSAYWVWPSHWRK
KLRFMRNEERDLVPSEKFKRLGVSREDRSALGDLPSDEPLHVQRSLALQENRALTNALEA
MDPIFAAHHVEARHPLYDRRVIELCLSLPADQRFKGGWTRSILRRSLRNVLPDKIRRRLG
KVTLEGVIAHNLRRFEKDRLSDFILDDALRPFVDREVATEMLDRFRESGEPDSACTRSLL
RMAVVSVWLRKRRHGNLKGPPQTVSLPKE
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcatcagtggaatcgtctcccgttcgaggaacccatccattcgtgctcacatc
gacatgatgacgcgaagtctggaccaccggggtccagacggaagtggagtctgggtcaat
gaggcgagaaacgttgctctcgggcacgtactgctggccacgactcctgagtcgaaggcc
gagcgtcagccgctcagcgacatgcctggcggagtcgcgctcaccgcggatcttcgaata
gacaaccgtgagagtattcaccgctctctgcgtctggagagcagcccgagtgatccgcta
acaagtccgaagcttctggcccgagcgtataggaagtggggggcagagtgcacagaccac
ctgtttggcgactatgcttatgcaatatgggacggtcaatcgggccatctgctctgtgtg
cgggacccaatgggcgtcaagcccctctactacgttagaacagattcaatatttgcattt
gcctctgaaataaggagtttgctcaccctgccaggcgtcagcgaccagattaataggcgg
caagtactcacgttcttgtctgggggctatactcctcgtgaagagacatttttcgagagc
atcaagtgcctagaaccggggcatttgatgcacgtcttccctgatctgtcgacttcgtcg
gaaaggtactggagccccgccagacagattgagaagttgagccttagaaaagactccgag
tacgaaaggaaattcagaaaagtgctggagcaggcagtcggtgccaacctccgcagcatc
ggtgaggtggggattctcctaagcggcggaatggattcctcttcagtggcctcggttgca
gatgcccacgagagatcttcatcggccccacttcacaccttttcgtacacgtttccctca
ctcaccgaacggaagcgccgattcgttgacgagcgtgaatacatcgacgcagtgctggaa
agcggcgaatttgaccctcactttctggacgctggcacgctgagcccgctccatcaactg
gaggacatggtcgaggtctggggccagccattcaatatccgcggcctatatacagtcagc
aagattcttgaaaatgcgcgcggaaacggcgtacgggttcttcttgacggcgcagagggc
gattcggttatcgggtacggatacgaccttcttacgcaactgggccgtgaggacgactgg
gagagatttgcagagattgcccgccagcactctgaaaactaccaggagggaagaagaaag
taccctcctgagaaggtattctggaaccatgggttcggggtcattgtcgagcaccttcgc
agaggccggctcaggcgcttttaccgaagtgccaacgctgtttcaaaacacctcggaata
ccgaggtatctgatactgaagcgatcagcgtactgggtatggcccagccattggagaaaa
aagctgcgcttcatgcggaatgaggagcgtgatctagtgccttctgagaagttcaaacgc
ctgggggtttctcgagaggatcgatcagctctgggtgatctcccgtcggatgaacccctg
catgttcagcgaagccttgcgcttcaggagaaccgggcattgacgaacgctctagaggcg
atggacccgatttttgccgcgcatcacgtcgaggcgcggcatccgctttacgacaggcgt
gtcattgagctctgcctatctcttcccgcagatcagcggtttaaaggaggatggacaaga
agcattctccgccgctctctacggaacgtgctccctgacaagataagacgacgactcggc
aaggtgacacttgaaggggtgattgcacataacctgcgtcgcttcgaaaaagatcgtctt
tcagattttatcctcgatgacgcgctccgcccgtttgtagaccgtgaggtggcaaccgag
atgctggatcggttccgcgagtcaggagagccggactctgcctgcactcgttctcttctc
cggatggcagtggtgagcgtctggctccggaaacggcggcatggaaacctaaagggcccg
ccgcaaacagtcagtcttccaaaagagtag

DBGET integrated database retrieval system