KEGG   Salinibacter ruber M8: SRM_00271Help
Entry
SRM_00271         CDS       T01209                                 

Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
srm  Salinibacter ruber M8
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:srm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323751..325796
Genome map
AA seq 681 aa AA seqDB search
MSGIAGIYYLDGRPVEEEIGRMVDVMKHRGPDEQSTWTNGSAGLGHCMLHTTPESLHASL
PRESAQSGCVITADARIDNRDVLIRDLQLSPSTGQVIPDSTLILRAYEEWGQDCVDHLLG
AFSFAVWDPRRDSLFCAVDHLGVKQFHYTRTPPQCFAFGSEIKALLLLDKVRCTIDEEKL
GEALAWISRAPDSTVFEDVERLPPAHALRVGNDGVRMWQYWEVEPSREARSLTEQECTRR
FKELFTEAVRCRLRSAFPVGAELSGGLDSSFVTCMADTLLPEGDDPIRTFSLIYDKVPSC
DEREYIEEVVKNKNTKPHYVCGDKIGPISSAQEMYEFVDDGRIGAGNSFLRWNVYAKAEK
ADVRVVLTGTDGDSTVSHGTERFAELAADEDWEVLHEIAQKYVKNLDRERGKYAIHGEDD
DSVEGVIQKAGFPYLDYWATTGQWQTFLRSAHKISSLCDISLLEIYRRFWKKLLAPEFVV
RARVRSAVKQERRKVPPVVDSDFAAAIGLPEKLSSYRDDIQETPSVRKNQIEKFRSGLIG
TELQHYDTHASAHSIEARHPFMDIRLLQFCMGMPSKMSFQSGWTRAIMREAMEGIVPEKI
RWRVAKTNMSDVFEHGLFDVDGDLAQSLLSDLDLMTKFSDKAHMREVLAKQERRHEFDFT
LLASVLSKEIWIEKLHEKEYC
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaatagcaggcatctactatttggacggacgtcccgtcgaggaggaaataggc
cggatggtcgacgtcatgaagcaccgggggccggatgagcagtcgacctggaccaacggc
tcggctgggctgggacattgcatgttgcatacgacccctgaatctctgcacgcatctctt
ccccgagaaagtgcgcagagcggctgtgtgatcactgccgacgctcgcattgacaaccga
gacgtcctcatacgggaccttcagctgtctccgagtaccggtcaagtaattccggacagc
acgctgattctccgcgcgtacgaggaatggggacaagactgcgtcgatcacctgctcggg
gcgttttccttcgcggtctgggaccccagacgtgattctctcttctgtgccgtcgaccat
ctgggagtaaagcagtttcactatacccgaaccccccctcagtgctttgctttcgggtcc
gaaattaaagcccttctgctccttgataaggtacgctgtacgatcgacgaggagaaactg
ggagaggccctagcctggatttctcgtgccccggattctacggtctttgaagatgtggag
agactgccgcccgctcatgcactcagggtcgggaacgatggcgtccgaatgtggcagtac
tgggaggtagagccttctagggaggcacgctcactcaccgagcaagaatgcaccaggcgt
ttcaaggaattgtttacagaagccgtcaggtgccgactgcggagcgcatttccagtcggt
gccgagctgagcggggggctagactcttcgtttgtcacgtgcatggcggacacccttttg
cccgaaggagacgaccccatcagaacattttcgctaatatacgacaaggtccctagttgt
gacgagagggagtacatcgaagaggtcgtcaaaaacaaaaatacaaagccgcactacgtg
tgcggcgacaaaatagggccgataagttcggcccaagaaatgtatgagtttgttgacgac
ggtcgtataggggcggggaattcgtttcttcggtggaatgtatacgctaaggcggaaaag
gctgatgtcagggtggtccttactggcacggatggggacagcacagtatcacatgggacc
gagcgttttgcagagcttgccgccgatgaagattgggaggtcctacatgagattgcccaa
aagtatgtcaaaaaccttgatcgggaacgaggaaaatatgcaatacacggagaggacgac
gattccgtggagggggttatacagaaggccgggtttccatatctcgactactgggccact
actggtcagtggcagacattcctgcgatctgcgcataagatcagcagcctctgcgatatt
tccctgctagagatatatcgtcgattctggaaaaaattactcgcccccgagtttgtagtc
agggcccgggttcggtcggccgtcaagcaggagcgacggaaagtgcccccagttgttgac
agcgattttgcagcagccattggtttgcctgaaaagctgtcgtcctaccgggacgacatt
caagagactccgtccgtgcgcaaaaaccagattgaaaagtttagaagtggattgatcggt
actgaactgcaacattatgacacccatgcctcggctcattctatagaggcccgtcatcca
ttcatggatattcgtcttctccaattctgcatgggaatgccgtccaagatgagttttcag
agcggatggacccgtgcaatcatgcgtgaagcaatggaaggaattgtccctgagaaaatc
cggtggagagtcgcgaaaacaaacatgtccgacgtcttcgagcacggactgtttgatgta
gacggcgaccttgcgcagtccttgctgtcagatctggacctgatgacaaagttttcagat
aaggcacacatgcgggaagtactcgccaagcaggaaagacgccacgagtttgacttcacg
ctcctcgcctctgtcctgagcaaggaaatctggattgaaaaactgcacgaaaaagagtat
tgttaa

DBGET integrated database retrieval system