KEGG   Salinibacter ruber M8: SRM_00298Help
Entry
SRM_00298         CDS       T01209                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
srm  Salinibacter ruber M8
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRM_00298 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SRM_00298 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SRM_00298 (phoA)
Enzymes [BR:srm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SRM_00298 (phoA)
Exosome [BR:srm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SRM_00298 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
358110..359732
Genome map
AA seq 540 aa AA seqDB search
MSHRDPPLPPGASCSPGAVCVWGLFLVNFAGLLECKLVRQHANFRYMPVRSSTFHLLPAS
RLVSAVRPFFAALVLCLLLAGPAPAQTVPDAPAPEEAPNVILMIPDGFGPASVTMARDYL
RWRDGQKELPYDSLQVGSIRTYASDSYITDSAAGGTALATGKKTYNGAVAVDTSRQAVAT
LLEGAERRGMSTGLVVTSRLTHATPAVFSSHVPDRGQENRIARQQLNKDIEVMLGGGRRH
FLPQSAEGSAREDDLDLLQAAQDRGYEVVQTASELSRAGEGQTQENRLLGLFSPGHMAYE
IDRDHTQQPSLAAMTETAIDRLSGNGEGYFLMVEGSRIDHAGHGNDAASHLRDILAFNRA
AKSALEAAQEDDNTLVVIVSDHETGGLTLGRNRDGEGIYSWRPETLAAVEASSGAIADSI
RSIRSTGASEAAKRKRIAGTLTRLTGVQDVPTEIVSNLMAVEGPYAVGQAVSPLVNRQAL
VGWTSHAHTAVDVNLYAYGPGANAFVGHHDNTTIAQKLANLMDVDLESLTGTLRAGRDAR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacagagatccccctctgccccccggggcttcgtgctcgccaggggccgtttgt
gtgtggggcttgtttctggtaaattttgcgggccttctagaatgcaagctcgttcgtcaa
cacgccaattttcgatacatgccggtgcgctcatccacgttccacttgctccctgcatcc
cgcctggtctccgcagtccgcccgttcttcgctgcccttgtcctttgcctgcttttggcc
ggtccggccccggcgcagaccgttccggatgcccctgcgcccgaggaggccccgaacgtt
atcctcatgatccctgatggcttcggccccgccagcgtgaccatggcccgggactacctc
cggtggcgcgacggccagaaggagcttccctacgatagcctccaggtggggagcattcgc
acctacgcctctgacagctacatcaccgactcggcggccgggggcacggccctcgctacg
ggcaaaaaaacctacaacggggcggttgcggtcgatacctcccgccaggcggtggcgacg
ctgctggagggggccgagcggcgcggcatgtccaccgggcttgtcgtgacgagtcgcctg
acccacgccaccccggcggtcttctcgtcccatgtgccggaccgcggccaggagaaccgc
atcgctcgccagcagctcaacaaggacatcgaggtcatgctgggtggggggcggcgccac
ttcctgcctcagtcggctgagggaagcgcccgggaggacgacctcgaccttctgcaggcg
gcccaggaccgggggtacgaggtggtccagacggcgagcgaattgagccgagccggcgag
ggccagacgcaggagaatcgccttctgggcctgttcagcccagggcacatggcctacgag
atcgaccgcgaccacacccagcagccaagcctcgcggcgatgacggaaaccgccatcgac
cgcctgtccggcaacggggagggatacttcctgatggtcgagggcagccgcatcgaccat
gccggccacggcaacgacgccgcttctcacctccgagacatcctggccttcaaccgggcg
gcaaagagcgcgctggaggctgcccaggaggacgacaacacgctggtggtcatcgtgtcg
gaccacgagaccggcggtctcacgctgggccgaaaccgggacggagaggggatctactcc
tggcgcccggagacgctggccgccgtggaggcctccagcggcgccattgccgacagcatc
cgatcgatccgctccaccggagcaagcgaggcggcaaagcggaagcgcattgccggcacg
ttgacccgcctgaccggcgttcaagacgtgccgacggagatcgtctccaacctgatggcg
gtcgaggggccctacgccgtcgggcaggccgtctctccacttgtcaaccggcaggccctg
gtcgggtggacgagccacgcccacacggcagttgacgtgaacctctacgcctacgggccc
ggggcaaacgcgtttgtcggccaccacgacaacaccaccattgcccaaaagcttgcaaac
ctcatggatgtggatctggagtcgctcaccggcaccctgcgtgcggggcgggacgcccgg
tag

DBGET integrated database retrieval system