KEGG   Salinibacter ruber M8: SRM_00347Help
Entry
SRM_00347         CDS       T01209                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
srm  Salinibacter ruber M8
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:srm00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:srm00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:srm02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
409815..410450
Genome map
AA seq 211 aa AA seqDB search
MQVRPVGFAGAFRRGAPPGGLVGSGGTESEPPSIPSEVKAQTPITRIAFGSCNDQAAPQP
LWAPIRAAEPDRWIWMGDNVYGDTLNMTALDSIYARQNRRPGHRTLRESTRVIGTWDDHD
HGANDAGRSYPKRDRSQAHVLDFMDVPEDHPGRERAGVYSAHTYGPPGKRAKVILLDTRH
HRDPITRAPISGQRYFPTRRGTSWARRSGSG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggtacggcccgtcggtttcgcaggtgcatttcgtcggggtgctcctcctggggga
ctggtcgggagtgggggcaccgagtcggagcccccgtccatccccagtgaggtgaaggcc
cagacgccaatcacgcgcatcgcgttcgggtcgtgcaacgaccaggcggccccacagccg
ctctgggcccccatccgggccgccgagccggatcggtggatctggatgggcgacaacgtc
tacggggacacgctcaacatgacggccctcgactcaatctatgcccggcagaaccgccgg
cccggccaccgtaccctccgcgagtcgacacgggtcattggcacgtgggacgaccacgac
cacggcgccaacgatgcgggccgctcctacccgaagcgggaccgcagtcaggcgcacgtc
ctcgacttcatggacgtgccggaggatcaccccggccgggagcgggcgggcgtctacagc
gcccacacctacggcccgcccgggaagcgcgcaaaggtgatcctgctcgacacgcgccac
caccgcgatccgatcacgcgcgccccgatcagtggccagcgctactttccaacgaggagg
gggacatcctgggcgaggcgcagtgggagtggctga

DBGET integrated database retrieval system