KEGG   Salinibacter ruber M8: SRM_00384Help
Entry
SRM_00384         CDS       T01209                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
srm  Salinibacter ruber M8
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SRM_00384 (nosZ)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     SRM_00384 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459226..461310
Genome map
AA seq 694 aa AA seqDB search
MPDDLPIPPVHPRYLVVPLRTADVGTICGAADRPLPLGTGRRGRAGRHVPWKARFSFWGK
KLFRIFLSKIRPPILMRSLTYLFLLVLPLGLLGCGGSSASGDGGDGGAPASYVPPGEKDD
YYLFYSGGHSGQVFVAGLPSLREIQEIPVFTPSPGHGYGFSKKSKKMMGEYRWGDVHHPG
LSKTDGTYDGRWLFVNDNANNRVARISLRDLKTKQILGPIPNSMGNHGSSFVTPNTEYLL
VATRFSVPLPKGTHAPVETYEENFNGIVSGVDIDPETGEMEVGWQVKTPPFNWDLGSTGK
GPSDGWAFWTSYNTEMAHDSLEINASQRDRDYAAFVNWERAEEVVENNEGLNRRNGVPLI
DPAEHEGVMYFVPVSKSPHGIDASPSGRWIAASGKLQPTTTVFDFKQFKTAIENEDFQGE
FRGVPVVNYDAVVEGEVPVGQGPLHTQFDGEGNAYTSLFIESSVTKWKLPPWDKETKEDM
SKAVTDKISVHYNIGHLVIPGSDTKEPYGNWLVAMNKLQKGRGLNVGPEKPETSQLIDIS
GEEMEMIEEDYTRPEPHFAQAVPADVINPIEVYKKENNDHPDARWDPENTGVERTGPDEV
TVHMIAKRSQYYPDKVEVQQGDKVTFHLTNIEQVSDMIHGFGIAQYNMNGVVPPGDTQTF
TITADEAGVYPFYCTNFCSALHQEMQGYLEVKPR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgacgacctccccattcctcccgtgcacccccgatatctggtcgtgccgcttcgc
accgccgacgtcgggacgatctgcggcgctgcagacaggccgttgccactcgggacggga
cggagggggcgtgctggcagacacgttccgtggaaggcccgcttttccttctggggtaaa
aagttgtttcgtatctttttgtctaaaatacgacccccgatacttatgcgatcactcaca
tacctcttcctgctcgtcctcccgttgggcctgttgggctgtggcgggtcgtccgcctcc
ggcgacgggggcgacggcggcgcgcccgcctcgtacgtcccccccggcgagaaggacgac
tactacctcttttactccggcggccactccggccaggtcttcgtggccggcctgccgtcc
cttcgcgagattcaagagatccccgtctttaccccctcccccggccacggctacggcttc
agcaagaagtcgaagaagatgatgggcgagtaccgatggggcgacgtgcaccaccccggc
ctctcgaagacggacggcacgtacgacggccgctggctcttcgtgaacgacaacgccaac
aaccgggtcgcgcgcatcagcctgcgggacttaaagacgaaacagatcctcggtcccatc
cccaactcgatggggaaccacggctcctccttcgtcacgccgaacaccgagtacctgctc
gtcgccacccgcttctcggtgccgctgccgaagggcacacacgcccccgttgagacctac
gaggagaatttcaacggcatcgtcagtggcgtggacatcgacccggagacgggcgaaatg
gaggtggggtggcaggtcaaaacgcccccgttcaactgggacctcggctccaccggcaag
ggcccgagtgacggctgggcgttctggacctcctacaacaccgagatggcgcacgactcc
ctggagatcaacgccagccagcgcgaccgcgactacgccgcgttcgtgaactgggagcgc
gccgaggaggtcgtcgagaacaacgagggcctgaaccgtcgcaacggggtgccgctcatc
gatccggccgaacacgagggcgtcatgtacttcgtgccggtcagcaagtccccccacggc
atcgacgcctcgccgtcgggccgctggatcgcggcctccggcaagctgcaaccgaccacc
acggtgttcgacttcaagcagttcaagaccgcgatcgaaaacgaggactttcagggtgaa
ttccgcggcgtgcccgttgtgaactacgacgccgtcgtggaaggcgaggtgccggtcggc
cagggcccgctccacacgcagttcgacggcgagggcaacgcctacacgtcgctcttcatc
gagtcgagcgtgacgaagtggaaactgccgccctgggacaaagagaccaaggaggacatg
agcaaggccgtgacggacaagatcagtgttcactacaacatcggccacctcgtcatcccg
ggcagtgacacgaaggagccgtacgggaactggctcgtggcgatgaacaagctccagaag
ggccgcgggcttaacgtcggccccgagaagccggagacgagccagctcatcgacatctcg
ggggaggagatggagatgatcgaggaagactacacccggcccgagccgcactttgcgcag
gccgtgccggcggacgtgatcaaccccatcgaggtctacaagaaggagaacaacgaccac
cccgacgcccgatgggacccggagaacaccggcgtggagcgcaccggcccagacgaggtc
accgtccacatgatcgccaagcgtagccagtactacccggacaaggtcgaggtgcaacag
ggcgacaaggtcacgttccacctgacgaacatcgagcaggtgtcggacatgatccacggc
ttcggcatcgcccagtacaacatgaacggagtggtgccccccggtgacacgcagacgttc
accatcacggccgacgaggcaggggtgtatcccttctactgcaccaacttctgctcggcg
ctccatcaggagatgcaggggtacctggaggtgaagccgcggtag

DBGET integrated database retrieval system