KEGG   Salinibacter ruber M8: SRM_00414Help
Entry
SRM_00414         CDS       T01209                                 

Gene name
cheB
Definition
(GenBank) Chemotaxis response regulator protein-glutamate methylesterase
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
srm  Salinibacter ruber M8
Pathway
srm02020  Two-component system
srm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:srm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SRM_00414 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SRM_00414 (cheB)
Enzymes [BR:srm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     SRM_00414 (cheB)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SRM_00414 (cheB)
Two-component system [BR:srm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SRM_00414 (cheB)
Bacterial motility proteins [BR:srm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SRM_00414 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 PAS_4 PAS_9 PAS CheR_N PAS_3 HisKA_3 HATPase_c HAUS-augmin3 CENP-F_leu_zip Fez1 PAS_8 HATPase_c_2 OmpH IncA DUF3540 Talin_middle DUF16 WEMBL DUF812 LMBR1 ERM KASH_CCD Spc7 ATG16 TPR_MLP1_2 AAA_23 COG5 CALCOCO1 DUF3584 Vps54_N Golgin_A5 Exonuc_VII_L Jnk-SapK_ap_N Atg14 APG6 Fusion_gly Laminin_II IFT57 DUF3552
Motif
Other DBs
NCBI-ProteinID: CBH23335
UniProt: D5H5N0
Position
495240..499019
Genome map
AA seq 1259 aa AA seqDB search
MKNKFVDTTLTVRCRFGRHEPVRATVGGFVHVGRVRPGPGSTFPECPRRRACASPFLQSA
TGCVADCMSSASKEAIQASPVGPGSDETSEQSVPVVAIGASAGGVGALRAFFEALPSDGG
MAFVVVLHLSPDHESSLAEILQYDTDMPVQTATDDCGLRPDHVYVIPPRHEMWVEGTQLR
LSAHSDRHRPHTIDALFDSLAEEHGAQAVGIVLSGTGTDGTLGLRAIKTHGGIAMVQEPA
DAGHEEMPRNALEAGVIDLVRPASELAEQLVAYHRNAHAIQLPESEEALPSGEQTTLQKI
FAALRTHTGHDFSHYKRSTVLRRLERRLQVTDTETLEAYLQVLQDRPGETRALYKELLIS
VTRFFRTPEAFDELADTVLPRLFEDTAADDEVRVWVPGCATGEEAYSVAMLLHEHARAAE
APPELQVFATDVDTEGLDTARRGTYPVSIEADVPDERLDRFFYREEDRYHVTSSLRNTVV
FAEHNLIEDPPFSKLDLICCRNLLIYLDQTMQEYVFRLFQYALDPGGFLFLGPSEAVGPA
QSSFSVVDDTRSILKAKPPAPDEDRPMPLFAPSRAASEPPSSSPSPVSAPTDVAATHRRL
LMDQVASLLVDENREIVHLTGRAGRFLEHNPGTPTHNLLEKVHPLLRLELRGALYQAFQK
GEATERTVPFPDAGDGPEHVRVRVQPLDDAEGGQRLAQVCFEEADAPGRGVDEDGEATVS
SKEPTERERDLESELQDVKEQLQITSEEHETVTEEMETANEELMSMNEELQAKNEELQTS
KEQLQSVNEELTTTNQQLNAKVEALDQANNDLQNLMEATQVGTLFLDRDLEIRRYTSPMT
DIFGLRSVDEGRPITDFTPKIAYDALVADAERVLEEQASIEREVEGPGRTWYLMRLRPYR
TVSGEVEGVVMTFVDITAQKHAAESLRAERDLVSALIDTAGALIVVLGEDGSIVRFNTAC
ERLTGYDAAEAEGTDLRDLLVAPDDREAVTSRLDALADGTTDRADLEMRWTPAEGEPRLI
KGSFTALRDESGAVQHFIVTGTDMTRHRELEREVIEISDRERQRIGEALHDVISSGLTHV
VMCTDTLAHRLTQEGTAVTADDLEGISSEVKEAADQIRSLSHALIPRALRQDHLAAALAD
LADEEEDFSDIDCTFVGDEGETRPEDETDAMNLYRIAHEAVANAREHADPSRIQLGLREE
GADLVLSIRDDGRGWEGDTPDDEGLGLHLMRYRANLIGATLRLTSDDGETVVECRLPLP
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaataaatttgtcgatacaacgctgacggtccgctgtcgattcgggagacatgag
ccggtgcgggcgactgtcggcgggttcgttcacgtcgggcgtgtccgtccgggtcccggt
tcaacattcccagagtgtcctcgtaggagagcgtgcgcgtcaccttttcttcaaagtgcg
acaggttgcgtcgcggattgcatgagctccgcttcgaaagaggccattcaggcatctcct
gtaggtccggggtcggacgagacgtcggagcagagcgtgccggtcgtggccattggggcg
tcggcggggggcgtgggggcgctccgtgcgttctttgaggcgttgccgagcgacgggggg
atggcattcgtcgtggtgttgcacctctcgcccgatcacgaaagcagcctcgccgagatt
ctccagtacgacaccgacatgccggtgcagacggcgacggacgactgtggtctgcggccg
gaccacgtctacgtcattccgccccggcacgagatgtgggtagaggggacccagcttcgc
ctgtcggctcattccgaccggcaccgtccccacaccatcgacgcgctgttcgactcgttg
gccgaggagcacggggcccaggccgtcggcatcgtgctgtcgggcaccggcacggacggc
acgctgggcctccgggccatcaagacgcacgggggcattgccatggtgcaggagcccgcc
gacgcggggcacgaggagatgccgcgcaatgcgttggaggcaggggtgattgatctcgtg
cgcccggcttccgagctcgcggagcagctggtggcctatcaccggaacgcccatgccatc
cagctgcccgagtccgaagaggcgctcccttccggcgagcagacgacgctccagaagatc
ttcgccgcgctgcggacccacaccgggcacgactttagccactacaagcggtcgaccgtg
ctgcggcggctcgaacggcggcttcaggtgaccgacaccgagacgctggaggcctacctc
caggtgctccaggaccggccgggagagacgcgggccctctacaaggaactgctcattagc
gtcacgcgctttttccggacgccggaggcattcgacgagttggcggacacggttctcccg
aggctgttcgaggacacggcggccgacgatgaggttcgggtgtgggtccccgggtgtgcc
acgggcgaggaggcgtactcggtggcgatgcttctgcacgagcatgcccgcgcggcggaa
gccccgccggagctgcaggtgtttgccaccgacgtggacaccgaagggctcgacacggcc
cggcggggcacgtatccggtgtctatcgaggccgacgtccccgacgagcgtctcgaccgt
ttcttctaccgggaggaggaccggtaccacgtcacgtcgtcgctccggaatacggttgtc
ttcgccgagcacaacctcatcgaggatccccccttttcgaagctcgacctgatctgctgc
cggaacctgcttatctacctggaccagacgatgcaggagtacgtgtttcggctgttccag
tacgcgctggacccgggaggatttctgttcctcgggccctcggaggccgtcggcccggcg
cagtcctcgttctcggtggtcgacgacacgcggagcatcctaaaggcgaaaccgcccgcg
cccgacgaggaccggccgatgccgctctttgccccatcgcgcgctgcgtcggagcccccc
tcgtcctccccgtctccggtgtcggcgccgacggacgtggccgccacgcatcggcgcctg
ctcatggatcaggtggcgagcctgctggtcgacgaaaaccgcgagatcgtgcacctgacg
gggcgggcgggacgctttctggagcacaatccgggcacccccacgcacaacctgctggaa
aaggtgcacccgctgctccgactcgaactgcgcggggcgctctaccaggcgttccagaag
ggggaggcgacggagcggaccgttccctttcccgatgcgggcgacgggcccgagcatgtg
cgggttcgggtgcagcccctcgacgacgccgaaggggggcagcgtctcgcacaggtctgt
tttgaagaggccgacgccccggggcggggcgtggacgaggatggcgaggcgaccgtgtcg
tcgaaggagccgacggagcgggagcgcgacctggaaagtgaacttcaggacgtcaaggag
cagctccagattacgagcgaggagcacgagaccgtcaccgaggagatggagacggccaac
gaggagctgatgtcgatgaacgaggagctccaggccaaaaacgaggagcttcagaccagc
aaggagcagctgcagtccgtcaacgaggagctgacgaccaccaaccagcagctcaacgcc
aaggtggaggcgctcgaccaggccaacaacgacctgcagaacctgatggaggcgacccag
gtgggcaccctgttcctggaccgggacctggagatccgccgctacacgtcgccgatgacc
gacatttttgggcttcggagcgtcgacgaggggcgtcccatcacggactttacccccaaa
attgcgtacgacgcgctggtggcggatgcggaacgtgtgcttgaggagcaggcctcaatc
gagcgtgaggtggagggccccggtcggacgtggtatctgatgcgtctccgcccgtaccgc
acggtgtcgggcgaggtggagggcgtggtgatgaccttcgtcgacatcaccgcccagaag
cacgccgccgagagtctgcgggcggagcgcgatctcgtgtcggctctcatcgacaccgcc
ggggccctgatcgtggtgctcggcgaggacgggtccatcgtgcgcttcaacacagcctgc
gagcgcctcaccggctacgacgccgcggaggcggaggggacggacctgcgcgatctgctc
gtggcccccgacgaccgggaggcggtgaccagccggctcgacgccctcgccgacgggacg
accgaccgggccgacctggagatgcggtggacgccggcggagggcgagccgcgcctcatc
aaagggtcatttacggccctccgggacgaatcgggggctgtgcagcacttcatcgtgacg
ggcaccgacatgacccggcaccgcgagctggagcgcgaggtcattgagatcagcgaccgg
gagcgccagcgcatcggagaggccctgcacgacgtcatcagctcggggctgacccacgtc
gtgatgtgcacggacaccctcgcccacaggctcacccaggagggcacggcggtgacggcc
gacgacttggagggcatttcgtcggaggtaaaggaggcggccgaccagatccgctccctc
tcccacgccctcattccccgggccctccggcaggaccacctggccgcggccctcgccgac
ctggccgacgaagaggaggacttctcggacatcgactgcacattcgtgggggacgaaggc
gagacgcgccccgaggacgagaccgacgcgatgaacctgtaccgcatcgcccacgaggcg
gtggccaatgcccgcgagcacgccgacccgagccgaattcagctcgggctgagggaggag
ggcgccgacctggtgctttccattcgggacgacgggcgcgggtgggagggagacaccccg
gacgacgaggggctcggcctgcacctgatgcgctaccgggccaacctcatcggggccacc
ctgcgtctgaccagcgacgacggggagacggtggtggagtgccgcctgccgcttccgtag

DBGET integrated database retrieval system