KEGG   Salinibacter ruber M8: SRM_00445Help
Entry
SRM_00445         CDS       T01209                                 

Gene name
chb
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
srm  Salinibacter ruber M8
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SRM_00445 (chb)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SRM_00445 (chb)
Enzymes [BR:srm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SRM_00445 (chb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543795..546452
Genome map
AA seq 885 aa AA seqDB search
MLVFRLRFARSMRHILLSFLLLLFGGTLAAHAQSDATHPPADELSIRWGVETNRVDDGNR
FRSSFTIANHGDVALGTTHWTLYFNFSRQIDPASVTAPVRITRLNGDFYRLEPDADLPPI
EPGDQLRVTVEAPGSVIKRIDAPAGFYVVFKDAEGRARPPAVVSDVTVEPFTRPAQTSRG
PGDTWPVPTPATRYADHRSLTARPPDAEGRIVPTPDSIHRRPGAFALRADATIRYEAGLA
AEARQLAAGLAAALGRRPRTTRTDSAAAITLRRAEAPRPAVDTASAEAYRLTVDPETGIT
ITGATDAGVFYGGQSLEAWLPVAAYRAPSSPVDVPAVQVLDAPRFDHRGLHLDVARNMQS
VAAVKRLLDIMAFYKLNTFHFHLTDDEGWRLAVEGLPELTRVGGRRGHTLDEQAHLMPSY
GSGPSPSPEASRGSGWYSRADYLDILRYAKARHITVMPEIDVPGHARAAIQAMEARTRRL
RAAGDTAAARAYRLRDPADTSDYESVQGWDDNVMNVCRPSTYRFLSTVVDELRGLHEAAG
APLPAVHVGGDEVPEGAWAGSPICDDYIARTEGVDGADDLFGHFLGRFQDTLATRGIAMA
GWEEVGLEEADHRSATTTPNEALVDDDVQPYVWSNIWGGGTEDRAYRLANAGYDVVMAQA
TNFYFDMAYSKHPREDGYYWAGFVDTKAPFAFVPFDLYKSADRTRMGHPIDPDTAFADQV
RLADTARNNIRGLQGQLWGETLRKPDRMEYMAVPRLLSLAERAWAPRPGWATLDDSGALR
ARRAEAWTAFANRLGHRELPRLSIRHPDWSYRLPPPGATVEAGTLRANVALPGLAVRYTT
DGTRPTATSPRYTAPVPVPEGATVRLRTFDTLGRGGRTVTVPTSP
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgttttccgcctgcgcttcgcccgctccatgcgtcacattttgctttccttcctc
cttctgctctttggcgggaccttggccgcgcacgcccagtccgacgccacgcatccgccc
gccgacgagctttccatccgctggggcgtggagacgaatcgggtggacgacggaaaccga
tttcggtcgtcgttcacgattgcgaaccacggggacgtggcgctgggcacgacgcattgg
acgctctacttcaacttctcgcgccagatcgacccggcgagcgtgacggcgccggtgcgc
atcacgcggctcaacggcgacttctatcggctggagccggacgccgacctccccccgatc
gagcccggcgaccagctgcgggtgacggtcgaggcccccgggtcggtcatcaagcgcatc
gacgccccggccggcttctacgtcgtgttcaaggacgcggagggccgggcccggccgccg
gccgtcgtgtcggacgtgaccgttgagcccttcacccgtcccgcccagacgtcccgcggc
ccgggcgacacctggcccgtcccgacccccgcgacccggtacgcggaccaccgctccctc
acggcccgcccgcccgacgcggagggacgcattgtgccgacgccggactccatccatcgg
cgtcccggggcgtttgcgctccgggcggacgcgaccatccgctacgaggcggggctggcc
gccgaggcccggcagctcgcggcggggctggccgcggcgctgggacgacggccccgaacg
acccggacggattccgccgccgccatcacgctccgccgcgccgaggcaccgcggcccgcc
gtcgatacggcgtcggccgaggcctaccggctcacggtcgatccggagacgggcatcacc
atcacgggcgcgaccgacgcgggcgtgttctacggggggcagagcctggaggcctggctc
ccggtggcggcctaccgggcgccgtcgtcgccggtggacgtgccggccgtccaggtcctg
gacgcgccccgatttgaccatcgggggctccacctcgacgtggcgcgcaacatgcagtcg
gtggcggcggtgaagcggctcctcgacatcatggccttctacaagctgaacacctttcac
ttccacctcaccgacgacgaggggtggcgcctggccgtcgagggcttgcccgagctgacc
cgtgtgggcggccgccgcggccacacgctcgacgagcaggcccacctgatgccgtcctac
gggtccgggcccagcccgtcccccgaggcgtcgcgcggaagcggctggtacagtcgggcg
gactacctcgacatcctgcgctacgcgaaggcgcgccacatcaccgtcatgcccgagatc
gatgtgcccggccacgcccgcgccgccatccaggcgatggaggcccggacgcgccgactc
cgggcggcgggagacacggcggcggcccgcgcgtaccggcttcgagacccggccgacacg
tcggattacgagtccgtgcaggggtgggacgacaacgtgatgaacgtgtgtcgcccatcc
acctaccgattcctgtcgaccgtcgtcgatgagctgcggggcctgcacgaggcggcgggg
gcgccgctcccggccgtccacgtgggcggggacgaggtgccggagggcgcgtgggcgggc
tctcccatctgcgacgactacatcgcgcgcaccgagggggtcgacggggccgacgatctc
ttcggccactttctgggccggtttcaggacacactcgccacgcgggggattgccatggcg
gggtgggaggaggtggggctggaagaggccgatcaccggtccgcaaccacaaccccgaac
gaggccctggtcgacgacgacgttcagccctacgtctggagcaacatctggggcggcggg
accgaagaccgcgcctaccggctggccaacgcgggctacgacgtggtgatggcgcaggcg
accaacttctacttcgacatggcctacagcaagcacccccgagaggacggctactactgg
gccggcttcgtcgacacgaaggccccgtttgccttcgtgccgttcgacctctataagagc
gccgaccgcacgaggatggggcaccccatcgaccccgatacggcctttgccgatcaggtg
cgcctcgccgacaccgcgcggaacaacattcggggcctgcagggacagctctggggggag
accctgcgcaaacccgaccggatggagtacatggccgtcccgcggcttctgagcctcgcc
gaacgggcgtgggccccgcggcccggctgggccacgctcgacgacagcggggcactccgg
gcccggcgggccgaggcatggacggcgtttgcaaatcggctcgggcaccgtgagctgccc
cgcctgagcattcgccacccggactggtcgtaccggctccccccgcccggggccacggtg
gaggcggggacgctgagggcgaacgtggccctgcccgggctggcggtccgctacaccacc
gacggcacccgcccgaccgccacgtcgccccgatacaccgccccggtgccggttcccgag
ggggccaccgtccgactgcggacgttcgacacgctggggcggggcggccggaccgtcacg
gtccccacatccccgtag

DBGET integrated database retrieval system