KEGG   Salinibacter ruber M8: SRM_00491Help
Entry
SRM_00491         CDS       T01209                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
srm  Salinibacter ruber M8
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRM_00491 (dfrA)
   00670 One carbon pool by folate
    SRM_00491 (dfrA)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SRM_00491 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(597524..598084)
Genome map
AA seq 186 aa AA seqDB search
MAFSSASLPTFDLAAALMPELVIIAAVAEDNRVIGQDKDLPWHIPEDLKRFKQLTTGHPL
LMGRRTFESIVHQFGGPLPDRKMVVLTTQDDYEAYPEVDTYASVDAALAALPDDATVFIG
GGESVYEQFLPHADRLELTLVEGAYEGDTFFPPFEHLIGDVFEETAVDARDGFRFVTYER
KNVDVD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcttccgcttctcttccaacctttgatcttgccgctgccctcatgcccgag
ctcgtcatcatcgccgccgtcgccgaagacaaccgggtcatcggtcaggacaaagacctg
ccctggcacatcccggaggacctgaagcgcttcaagcaactcaccaccgggcaccccctc
ttgatgggccgccgcacgttcgagtccatcgtgcaccagttcggcggcccgctgcccgac
cgaaagatggtggtcctcaccacgcaggacgactacgaggcgtaccccgaggtcgacacc
tacgcgtccgtcgacgcggccctcgcggccctgcccgacgacgccaccgtcttcatcggc
gggggcgagtccgtctacgaacagtttctcccgcacgccgaccggctcgagctcaccctg
gtggagggcgcgtacgagggcgacaccttcttccccccgttcgagcacctcatcggggac
gtgtttgaggagaccgccgtggacgcccgggacggcttccgcttcgtcacctacgagcgg
aagaacgtggacgtggactga

DBGET integrated database retrieval system