KEGG   Salinibacter ruber M8: SRM_00561Help
Entry
SRM_00561         CDS       T01209                                 

Gene name
lysC
Definition
aspartate kinase
Orthology
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
srm  Salinibacter ruber M8
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:srm01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:srm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:srm00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:srm00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:srm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691206..692159
Genome map
AA seq 317 aa AA seqDB search
MPDRSSSSTECASRPVRVLKFGGTSVGSADGIKNAVRLVHAATETCRPVVVVSAAAGVTD
ALVQAAEESRADRGSVEAWTRRVGRRYRALAANTLADEALRARYDTALRAELSELRRALQ
EMAGPNAAAARDVVLAAGERLMVPLLAAALDASGCTSQAVDAATLIRTDAAHGDATVQWA
PTRRQVRDWHRTRAAGLPVVTGFVGETADGKTTTLGRGGSDLSAAVLAWALAAERMERWT
DVEGLYTRDPDAHSDAQPLQRIDFEQARAWTKAGRLGMHPCTLDPLMDAGIPLRVRCTHR
PAAPGTRIVPAPTLAQG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatcgttcctcctcttcgacggaatgcgcgtcccgtcccgtccgcgttctcaaa
tttggcggcacgtcggtcggctccgccgacggcataaaaaacgcggtccgcctcgttcat
gccgccaccgagacctgtcggccggtcgtggtggtgtctgccgcggcgggcgtgacggac
gccctcgtgcaggccgcagaggagtcccgggccgaccgtggctccgtcgaggcctggacg
cggcgggtggggcggcgctaccgcgccctggccgcgaacacccttgccgacgaggcgctg
cgggcccgctacgacaccgccttgcgggcagagctctcggagctgcgccgcgcgctgcag
gagatggcggggccaaacgccgccgcggctcgtgacgtcgtgctggccgccggcgaacgg
ctgatggtgccgctgctggccgccgcactcgacgcctccgggtgcacatcgcaggccgtc
gacgcggcgacactcatccgcaccgacgccgcgcacggtgacgcgacggtgcagtgggcc
cccacccggcggcaggtgcgcgactggcatcggacgcgggccgccggcctgccggtcgtc
acgggcttcgtgggggagacggccgacggcaagacgaccacgctcggccgcgggggaagt
gacttgtccgctgccgtcctcgcctgggcgctggcggcggaacggatggagcgctggacc
gacgtggagggcctgtatacccgcgacccggatgcgcacagcgacgcgcagcccctccaa
cgcatcgacttcgagcaggcccgcgcctggacgaaagccggacggctcggcatgcatccg
tgcaccctcgatccgctgatggacgccggcattccgctccgcgtccggtgcacgcaccgc
cccgcggccccgggcacccgcatcgtccccgccccaactctcgctcaggggtaa

DBGET integrated database retrieval system