KEGG   Salinibacter ruber M8: SRM_00567Help
Entry
SRM_00567         CDS       T01209                                 

Gene name
sdhA
Definition
succinate dehydrogenase flavoprotein subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
srm  Salinibacter ruber M8
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRM_00567 (sdhA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SRM_00567 (sdhA)
   00650 Butanoate metabolism
    SRM_00567 (sdhA)
  Energy metabolism
   00190 Oxidative phosphorylation
    SRM_00567 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(700812..701264)
Genome map
AA seq 150 aa AA seqDB search
MAQTNALNWFLHRITGTFLIFMLITHFWVQHYDHQAASVTHEVVTEKNEMPDYPDEAKEG
VKARFGPDAEATPYQVVMQRLADPVYAVLWKGFNILFLVVALHHGFYGLNNVMTDYIRDP
MGRLVAKSLSWTVALGLLIIGTYSVLTAGW
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaccaacgcgctgaactggtttcttcaccgcatcaccggcaccttcctcatc
ttcatgctgatcacccacttttgggtgcagcactacgaccaccaggccgcctcggtcacc
cacgaggtggtgacggagaagaacgagatgccggactacccggacgaggcgaaggagggc
gtgaaggcccgcttcgggccggacgccgaggccaccccgtaccaggtggtgatgcagcgg
ctggccgacccggtctatgcggtgctgtggaaggggttcaacatcctgttcctcgtcgtg
gccctccaccacggcttctacggcctgaacaacgtgatgaccgactacatccgcgacccc
atgggccgactggtggccaagtcgctgtcgtggacggtggccctcgggctgctcatcatt
ggaacctactcggtgcttacggccgggtggtga

DBGET integrated database retrieval system