KEGG   Salinibacter ruber M8: SRM_00682Help
Entry
SRM_00682         CDS       T01209                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3 5-epimerase-like protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
srm  Salinibacter ruber M8
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SRM_00682 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SRM_00682 (rfbC)
Enzymes [BR:srm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SRM_00682 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
828411..828971
Genome map
AA seq 186 aa AA seqDB search
MTVSETSLPGVRLIEPDVYLDDRGSFAEMWNVRDYGHHGLDVTFVQDNLSRSREGVLRGL
HFQNPRAQGKLISVLEGAVYDVVVDVRTGSDTFGDWEGQVLSAESGRQLYAPEGYAHGFV
ATSGEVLFHYKCTDFYHPEADRTVRWDDPALAIDWPTEDPILSAKDAGAPALEELPREAL
RFDDAR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtctctgagacctcccttcctggcgtgcgcctcatcgagccggacgtctacctg
gacgatcgcggctcgttcgccgagatgtggaacgtgcgggactacggccaccacggcctc
gacgtcacgttcgtgcaggacaacctgtcccggtcccgcgaaggggtactgcgggggctg
cacttccagaacccccgggcgcaggggaagctgatttcggtgctggagggcgccgtctac
gacgtggtcgtcgacgtgcggacgggatcggatacgttcggggactgggaggggcaggtc
ctctcggccgaaagcggccggcaactgtacgcgccggagggctacgcccacggcttcgtg
gcgacgagcggcgaggtcctcttccactacaagtgcaccgacttttaccacccggaggcc
gaccggacggtccgctgggacgacccggcccttgctatcgactggccgacagaagacccg
attctctcggcaaaggacgcaggggcgcctgcgctggaggagctgccccgcgaggccctt
cggtttgacgatgctcggtag

DBGET integrated database retrieval system