KEGG   Salinibacter ruber M8: SRM_00890Help
Entry
SRM_00890         CDS       T01209                                 

Gene name
adh
Definition
(GenBank) Alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
srm  Salinibacter ruber M8
Pathway
srm00010  Glycolysis / Gluconeogenesis
srm00071  Fatty acid degradation
srm00350  Tyrosine metabolism
srm00625  Chloroalkane and chloroalkene degradation
srm00626  Naphthalene degradation
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
srm01130  Biosynthesis of antibiotics
srm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_00890 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SRM_00890 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SRM_00890 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SRM_00890 (adh)
   00626 Naphthalene degradation
    SRM_00890 (adh)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SRM_00890 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 SIS_2 Methyltransf_25 Methyltransf_11 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBH23811
UniProt: D5H706
Position
complement(1016070..1017158)
Genome map
AA seq 362 aa AA seqDB search
MPCPTVFMNALVYDDFDAPLTLRTVSRPTPTPRGVVLEVLACGVCRSDWHGWKGHDPMIT
PPNVPGHEVVGIVTAVGDRVEEWSGGERVTVPFVGGCGTCAQCRAGQHQVCPHQFQPGFS
APGAFAEYVGIDYADENLVRLPGSIDAVTGASLGCRFATAFRAVVDQGAVRSGEWVAVHG
CGGVGLSAVMIARAVGARVVAVDIADPALALADEVGASRTINADDTEDVAAAVREATRGG
AHLSLDALGSPDTCRNSVANLRTHGRHVQVGLLVGEHARTAIPFDRVVADELEVRGAHGL
QAHRYPALFNMIETGCLHPRQLVRQTISLPEAADCLQKMGDFAGTGIAVIDDFGGGRTQA
AV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgccgtgtcccactgttttcatgaacgccctcgtctacgacgattttgacgcgcccctg
acgctccggacggtttcacggcccacccctacgccgcggggcgtcgtgctggaggtgctt
gcgtgtggggtgtgccggagcgactggcacggctggaagggacacgacccgatgatcacc
ccgccgaacgtgccggggcacgaggtcgtggggatcgtgacggcggtcggggaccgtgtg
gaggagtggtctgggggggagcgcgtgacggtgccgttcgtgggcggctgcggcacgtgc
gcccagtgccgcgccggccagcatcaggtgtgccctcatcagtttcaacccggcttttcg
gccccgggggccttcgccgagtacgtgggcatcgactacgccgacgagaacctggtccgc
cttccggggtcgatcgacgcggtcaccggagcgagcctcggctgccgcttcgccaccgcc
ttccgggccgtggtcgaccagggagcggtgcgcagcggcgagtgggtggccgtccacggg
tgcggcggcgtgggcctgtcggccgtcatgattgcccgggccgtcggcgcccgggtcgtc
gcggtggacattgccgatccggccctcgcgctcgccgacgaggtgggggccagccgcacg
atcaacgccgacgacaccgaggacgtggccgccgccgtccgcgaggccaccaggggcggc
gcccacctctccctcgacgccctgggcagcccggacacgtgccgcaactccgtagcgaac
ctgcggacgcacggccggcacgtccaggtcggcctcctggtgggcgagcacgcacgcacc
gccattcccttcgaccgcgtggtggccgacgagctggaggtgcgcggcgcacacggcctg
caggcccaccgctatccggccctcttcaacatgatcgagacgggctgcctccacccccgt
cagctcgtccggcagacgatctcgcttccggaggcggccgattgcctgcagaagatgggc
gacttcgccggcacgggcatcgccgtgattgatgacttcgggggaggcaggacacaggca
gcggtgtga

DBGET integrated database retrieval system