KEGG   Salinibacter ruber M8: SRM_00890Help
Entry
SRM_00890         CDS       T01209                                 

Gene name
adh
Definition
Alcohol dehydrogenase, zinc-containing
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
srm  Salinibacter ruber M8
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SRM_00890 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_00890 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SRM_00890 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SRM_00890 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SRM_00890 (adh)
   00626 Naphthalene degradation
    SRM_00890 (adh)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SRM_00890 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1016070..1017158)
Genome map
AA seq 362 aa AA seqDB search
MPCPTVFMNALVYDDFDAPLTLRTVSRPTPTPRGVVLEVLACGVCRSDWHGWKGHDPMIT
PPNVPGHEVVGIVTAVGDRVEEWSGGERVTVPFVGGCGTCAQCRAGQHQVCPHQFQPGFS
APGAFAEYVGIDYADENLVRLPGSIDAVTGASLGCRFATAFRAVVDQGAVRSGEWVAVHG
CGGVGLSAVMIARAVGARVVAVDIADPALALADEVGASRTINADDTEDVAAAVREATRGG
AHLSLDALGSPDTCRNSVANLRTHGRHVQVGLLVGEHARTAIPFDRVVADELEVRGAHGL
QAHRYPALFNMIETGCLHPRQLVRQTISLPEAADCLQKMGDFAGTGIAVIDDFGGGRTQA
AV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgccgtgtcccactgttttcatgaacgccctcgtctacgacgattttgacgcgcccctg
acgctccggacggtttcacggcccacccctacgccgcggggcgtcgtgctggaggtgctt
gcgtgtggggtgtgccggagcgactggcacggctggaagggacacgacccgatgatcacc
ccgccgaacgtgccggggcacgaggtcgtggggatcgtgacggcggtcggggaccgtgtg
gaggagtggtctgggggggagcgcgtgacggtgccgttcgtgggcggctgcggcacgtgc
gcccagtgccgcgccggccagcatcaggtgtgccctcatcagtttcaacccggcttttcg
gccccgggggccttcgccgagtacgtgggcatcgactacgccgacgagaacctggtccgc
cttccggggtcgatcgacgcggtcaccggagcgagcctcggctgccgcttcgccaccgcc
ttccgggccgtggtcgaccagggagcggtgcgcagcggcgagtgggtggccgtccacggg
tgcggcggcgtgggcctgtcggccgtcatgattgcccgggccgtcggcgcccgggtcgtc
gcggtggacattgccgatccggccctcgcgctcgccgacgaggtgggggccagccgcacg
atcaacgccgacgacaccgaggacgtggccgccgccgtccgcgaggccaccaggggcggc
gcccacctctccctcgacgccctgggcagcccggacacgtgccgcaactccgtagcgaac
ctgcggacgcacggccggcacgtccaggtcggcctcctggtgggcgagcacgcacgcacc
gccattcccttcgaccgcgtggtggccgacgagctggaggtgcgcggcgcacacggcctg
caggcccaccgctatccggccctcttcaacatgatcgagacgggctgcctccacccccgt
cagctcgtccggcagacgatctcgcttccggaggcggccgattgcctgcagaagatgggc
gacttcgccggcacgggcatcgccgtgattgatgacttcgggggaggcaggacacaggca
gcggtgtga

DBGET integrated database retrieval system