KEGG   Salinibacter ruber M8: SRM_00963Help
Entry
SRM_00963         CDS       T01209                                 

Gene name
glcK
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
srm  Salinibacter ruber M8
Pathway
srm00010  Glycolysis / Gluconeogenesis
srm00052  Galactose metabolism
srm00500  Starch and sucrose metabolism
srm00520  Amino sugar and nucleotide sugar metabolism
srm00521  Streptomycin biosynthesis
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
srm01130  Biosynthesis of antibiotics
srm01200  Carbon metabolism
Module
srm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_00963 (glcK)
   00052 Galactose metabolism
    SRM_00963 (glcK)
   00500 Starch and sucrose metabolism
    SRM_00963 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SRM_00963 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SRM_00963 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SRM_00963 (glcK)
Enzymes [BR:srm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SRM_00963 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: CBH23884
UniProt: D5H779
Position
complement(1091644..1092627)
Genome map
AA seq 327 aa AA seqDB search
MSSYAIGVDIGGTNLKAALVAREDGLIEQTQRPTEARQGPEHVTSQITGLVADLIDLAPS
DAVMGVGIGAPGAVNWERTTVSHPPNIDDWESVNLRASLQSRLGRSLPIIVENDANVAAL
GSAFHGAGRHVDSFIMVTLGTGVGGGIIYQNKIFRGSTGGAGEIGHMTVDYEGPFANTGV
GGAIEGYLGQRFLTRHARDRIVNYPDSTVRDLVEGDLDQMSPRTLYDAATQGDEFAQAML
AWAGHKLGCVLGSAVNLLDIRTIVVGGGVSAAGDYILDPARDVLPRFVTPGLQDDLQIHR
EDLGNEASLLGAARLAFEGKDAQVGTR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgtacgccattggggttgacattggcgggacgaacctgaaggccgccctcgtg
gcccgcgaggacggcctgatcgaacaaacccagcgtcccacggaagcccggcaggggccc
gagcacgtcacgtcccagatcacgggcctcgtcgcggacctgatcgatctcgccccgtcg
gatgccgtgatgggcgttggaattggggcccccggcgccgtgaactgggagcgcacaacg
gtatcccacccgcccaatatcgacgactgggaatccgtcaacctgcgcgcatcccttcag
tcgcggctcggccggtccctccccatcatcgtggagaacgacgcgaacgtggccgccctc
ggatccgccttccacggggccggccggcacgtcgactcttttatcatggtcaccctcggc
accggcgtgggcgggggcatcatataccagaacaaaatctttcggggtagcacgggcggg
gccggcgagattggacacatgacggtcgactacgaagggccgttcgccaacacgggcgtg
ggcggggccatcgaaggatacctcggccagagattcctaacccgtcacgcccgcgaccgg
atcgtcaactaccccgacagcaccgtccgggacctcgtggagggcgatctggaccagatg
tcgccccgcacgctgtacgacgcggccacgcagggcgacgagtttgcgcaggccatgctg
gcctgggccggccacaaactcgggtgcgtgctcggctccgccgtaaatcttctggacatt
cgaaccattgtggtgggcgggggcgtttctgcggccggagactatattctcgatcctgcc
cgcgacgtcctcccccgcttcgtcacgccgggccttcaggacgacctccaaattcaccgg
gaagacctcgggaacgaggccagtcttctcggggcggcccgcctcgcctttgaaggcaag
gacgcccaggttggaacccgatag

DBGET integrated database retrieval system