KEGG   Salinibacter ruber M8: SRM_00990Help
Entry
SRM_00990         CDS       T01209                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
srm  Salinibacter ruber M8
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRM_00990 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SRM_00990 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SRM_00990 (sucB)
Enzymes [BR:srm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SRM_00990 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1125650..1127575)
Genome map
AA seq 641 aa AA seqDB search
MGVIPYIGSPSTRRLPGPPPRILTARHTTEIMAQVDVEMPKMGESITEGTVIAWHKQPGD
EVEQDEILLEIGTDKVDTEVPSPKGGVLTETLVEEGDTVEVGTIIATLDTDTTAAEVDAD
DAPPAEAPAEDEAAADEAADDASDADAEDDAEAEAAPPETDSEEAASPAPSGDEVEVVMP
KMGESITEGTVVAWYKDIGEAVAIDETILEIGTDKVDTEVPSPAEGVLTEKLVEEGETVE
VGTVVALLASEAEAGSVEPPASDEPDATQETAPEADEAELPSTPPSGDGAVPDADEPQRA
PEETITRRGDDGRFYSPLVRSIAKEEGLRMSELESLEGSGRGGRVTKEDVLAYLDEREEA
PAAPASAPERPPRPGRSDEAPPARGDYTVDEGPSDEELRQQYGDRIEVQPMDRMRKMTAE
HMVRSKATSAHVTSFAEADVTGLVQLREANKEAFREREGVKLTYTPFFVKAAVEALREHP
LLNASVEGDKIVIKHDFHVGIAVAIGNKGLLAPVIRNAGDYNVSGLARKAANVAERARNK
ELQPDELQGGTFTVTNIGSLGSLMGTPIINQPQVGILATGAIQKRPVVVENDGLGDAISV
RHMMYLSLSYDHRIIDGAMGSSFLQRVVTELESFSADADLF
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtcattccctacattggaagtccttccacacggcgtctccccggaccgccacca
cgcattctcactgcacggcacacgaccgaaatcatggcacaagttgacgttgaaatgccc
aagatgggcgagagcattaccgaaggcaccgtcattgcctggcacaagcagcccggcgac
gaggtggagcaggacgagattctgctcgaaatcgggaccgacaaggtcgatacggaagtg
ccctcccccaagggcggcgtgctcacggagacgctcgtcgaggagggcgacacggtggag
gtgggaaccatcatcgcaacgctagacaccgacacaacagccgcggaggtggacgccgac
gacgccccgcccgccgaggccccggccgaggacgaagcggccgcggacgaggcggcagac
gacgcctccgatgcggacgccgaggatgatgcggaggcggaggcggcgcccccagagacg
gattcagaagaagctgcgtctccggccccctccggcgacgaggtggaggtcgtgatgccc
aagatgggcgagagcattaccgagggcaccgtcgtcgcctggtacaaggacatcggcgag
gcggtcgccatcgacgagaccattctggagattggcaccgacaaggtggacacggaggtg
ccctcccccgccgagggcgtgcttaccgagaagctcgtcgaggagggcgaaaccgtcgag
gtcggcacggtcgtggccctcctggcctcggaggcggaggccggatcggtggagcccccc
gcgtccgacgagcccgacgccacgcaggagacggcccccgaggccgacgaggcggagctg
ccctccacgcccccctccggcgacggggcggtgcccgacgccgacgagccgcagcgcgcc
cccgaggagacgattacgcgccgcggcgacgacgggcgcttctactcgcccctcgtgcgc
tcgatcgcgaaggaggaagggcttcgcatgagcgagctggagtcgcttgagggctccggc
cggggcggtcgcgtgacgaaggaggacgtgctcgcctacctcgacgaacgcgaggaggcc
cccgcggcccctgcatccgcccccgagcggccgccgcgccccggtcgttcggacgaggcc
ccccccgcccgcggcgactacacggtcgacgagggcccgagcgacgaggagctgcgccag
cagtacggcgaccgcatcgaggtgcagcccatggaccggatgcgcaagatgaccgccgag
cacatggtgcggtcgaaagccacgtctgctcacgtcacctccttcgccgaggccgacgtg
acgggcctggttcagctccgggaggccaacaaggaggcctttcgggagcgcgagggcgtg
aagctgacgtacacgcccttcttcgtgaaggccgcggtggaggcgctccgcgaacatccc
ttgctcaacgcgagcgtggagggcgacaagattgtcatcaagcacgacttccacgtcggc
atcgccgtagccatcggcaacaagggcctcctcgccccggtcattcgcaacgcgggggac
tacaacgtgtcggggctggcccgcaaggcggcgaacgtggccgaacgggcccgcaacaag
gagctccagcccgatgagctgcagggcggcaccttcacggtcaccaacatcggctcgctc
ggctccctgatgggcacgcccatcatcaaccagccgcaagtgggcatcctcgccaccggg
gccattcagaagcggccggtcgtcgtggaaaacgacggcctcggcgacgccatctccgtg
cgccacatgatgtacctttccctcagctacgaccaccgcattatcgacggcgccatgggg
tccagcttcctgcagcgcgtggtgacggagctggagtccttttccgcggacgcggacctg
ttctaa

DBGET integrated database retrieval system