KEGG   Salinibacter ruber M8: SRM_01004Help
Entry
SRM_01004         CDS       T01209                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase isozyme 1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
srm  Salinibacter ruber M8
Pathway
srm00010  Glycolysis / Gluconeogenesis
srm00030  Pentose phosphate pathway
srm00051  Fructose and mannose metabolism
srm00052  Galactose metabolism
srm00680  Methane metabolism
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
srm01130  Biosynthesis of antibiotics
srm01200  Carbon metabolism
srm01230  Biosynthesis of amino acids
srm03018  RNA degradation
Module
srm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_01004 (pfkA)
   00030 Pentose phosphate pathway
    SRM_01004 (pfkA)
   00051 Fructose and mannose metabolism
    SRM_01004 (pfkA)
   00052 Galactose metabolism
    SRM_01004 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SRM_01004 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SRM_01004 (pfkA)
Enzymes [BR:srm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SRM_01004 (pfkA)
Protein phosphatases and associated proteins [BR:srm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SRM_01004 (pfkA)
Messenger RNA biogenesis [BR:srm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SRM_01004 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CBH23925
UniProt: D5H7C0
Position
complement(1142116..1143198)
Genome map
AA seq 360 aa AA seqDB search
MVWWWRALGPSGEGQPGPLPSSLFPVIDPSRPTMQDIECLGVYTSGGDAPGMNACLRAVV
RTAIANDIAVMGIRRGYEGMIEADFVEMERRSVSNILQSGGTILKSARSEAFRTEEGRRA
AANSLRENGIDALVAIGGDGTFRGASKLYDEHGLGVVGCPGTIDNDLYGTDQTIGYDTAL
NTAIDNIDRIRDTADAHNRLFLVEVMGRDAGFIALNSGIGGGAELILIPETITEMDMVKE
RILSLMTAQRRSTIVVVAEGDELGGAQGIERALRDDAAFSDIELRSTILGHTQRGGAPTA
SDRVLASRLGVAAVESLMDGHSDVMVGMTNNEIKLTPLRNVYGRRKSIDYDLLKLTQILS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttggtatggtggtggcgcgccctcggcccgtccggtgagggccagcccgggccgctgcct
tcttctcttttccccgtcatcgacccctctcgaccgaccatgcaggacatcgagtgcctc
ggcgtgtacaccagtggcggcgacgccccgggcatgaacgcgtgcctccgggccgtcgtc
cgcacggccatcgccaacgacattgcggtgatgggcatccgtcgggggtacgagggcatg
atcgaggccgacttcgtggagatggagcggcgctcggtctccaacatcctccagtcgggc
ggcacgatcctcaagagtgcccggtcggaggcctttcgcaccgaggagggacgccgggcg
gcggccaacagcctccgcgagaacggcatcgacgccctcgtggccattgggggggacggc
acgtttcggggggcctcgaagctctacgacgaacacgggctcggggtggtgggctgcccg
ggaaccatcgacaacgacctgtacggcaccgaccaaacgatcgggtacgacacggccctc
aatacggccatcgacaacatcgaccgcatccgcgatacggccgacgcccacaaccggctg
ttcctcgtggaggtgatggggcgggacgccgggtttattgccctcaactccggcatcggg
ggcggggcggagctgatcctgatccccgaaaccatcacggagatggacatggtaaaggag
cgcatcttgtccctcatgacggcccagcggcgctccaccatcgtggtcgtggccgagggg
gacgagctgggcggggcccagggcatcgagcgcgcgctgcgggacgacgcggccttctcg
gacatcgagctccgctctaccattctcggccacacgcagcggggcggggccccgacggcc
agcgaccgggtcctggcgagccgcctcggcgtagccgccgtcgagtccttgatggacggc
cattcggatgtgatggtgggcatgaccaacaacgagatcaagctcacgcccctccgcaac
gtctacggccggcgcaagtcgatcgactacgacctgctgaagctgacgcagattctgagc
taa

DBGET integrated database retrieval system