KEGG   Salinibacter ruber M8: SRM_01004Help
Entry
SRM_01004         CDS       T01209                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
srm  Salinibacter ruber M8
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRM_01004 (pfkA)
   01230 Biosynthesis of amino acids
    SRM_01004 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_01004 (pfkA)
   00030 Pentose phosphate pathway
    SRM_01004 (pfkA)
   00051 Fructose and mannose metabolism
    SRM_01004 (pfkA)
   00052 Galactose metabolism
    SRM_01004 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SRM_01004 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SRM_01004 (pfkA)
Enzymes [BR:srm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SRM_01004 (pfkA)
Protein phosphatases and associated proteins [BR:srm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SRM_01004 (pfkA)
Messenger RNA biogenesis [BR:srm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SRM_01004 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1142116..1143198)
Genome map
AA seq 360 aa AA seqDB search
MVWWWRALGPSGEGQPGPLPSSLFPVIDPSRPTMQDIECLGVYTSGGDAPGMNACLRAVV
RTAIANDIAVMGIRRGYEGMIEADFVEMERRSVSNILQSGGTILKSARSEAFRTEEGRRA
AANSLRENGIDALVAIGGDGTFRGASKLYDEHGLGVVGCPGTIDNDLYGTDQTIGYDTAL
NTAIDNIDRIRDTADAHNRLFLVEVMGRDAGFIALNSGIGGGAELILIPETITEMDMVKE
RILSLMTAQRRSTIVVVAEGDELGGAQGIERALRDDAAFSDIELRSTILGHTQRGGAPTA
SDRVLASRLGVAAVESLMDGHSDVMVGMTNNEIKLTPLRNVYGRRKSIDYDLLKLTQILS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttggtatggtggtggcgcgccctcggcccgtccggtgagggccagcccgggccgctgcct
tcttctcttttccccgtcatcgacccctctcgaccgaccatgcaggacatcgagtgcctc
ggcgtgtacaccagtggcggcgacgccccgggcatgaacgcgtgcctccgggccgtcgtc
cgcacggccatcgccaacgacattgcggtgatgggcatccgtcgggggtacgagggcatg
atcgaggccgacttcgtggagatggagcggcgctcggtctccaacatcctccagtcgggc
ggcacgatcctcaagagtgcccggtcggaggcctttcgcaccgaggagggacgccgggcg
gcggccaacagcctccgcgagaacggcatcgacgccctcgtggccattgggggggacggc
acgtttcggggggcctcgaagctctacgacgaacacgggctcggggtggtgggctgcccg
ggaaccatcgacaacgacctgtacggcaccgaccaaacgatcgggtacgacacggccctc
aatacggccatcgacaacatcgaccgcatccgcgatacggccgacgcccacaaccggctg
ttcctcgtggaggtgatggggcgggacgccgggtttattgccctcaactccggcatcggg
ggcggggcggagctgatcctgatccccgaaaccatcacggagatggacatggtaaaggag
cgcatcttgtccctcatgacggcccagcggcgctccaccatcgtggtcgtggccgagggg
gacgagctgggcggggcccagggcatcgagcgcgcgctgcgggacgacgcggccttctcg
gacatcgagctccgctctaccattctcggccacacgcagcggggcggggccccgacggcc
agcgaccgggtcctggcgagccgcctcggcgtagccgccgtcgagtccttgatggacggc
cattcggatgtgatggtgggcatgaccaacaacgagatcaagctcacgcccctccgcaac
gtctacggccggcgcaagtcgatcgactacgacctgctgaagctgacgcagattctgagc
taa

DBGET integrated database retrieval system