KEGG   Salinibacter ruber M8: SRM_01008Help
Entry
SRM_01008         CDS       T01209                                 

Gene name
dfrA
Definition
dihydroflavonol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
srm  Salinibacter ruber M8
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1145523..1146527
Genome map
AA seq 334 aa AA seqDB search
MASSHSVLVTGATGFVGSVLTRQLVDAGTDVRIFRRDTSSLDLLGTYAERVDHAVGDLRR
ARSLYEAMQGVDRVYHVAAKVSFARGDRAAVRRVNADGTAHVVNAALKAGVDRLVHTSSI
AALGRPPEPDGAIDETTEWQGLPHRSAYARSKRRAELEVHRGIAEGLDATLVNPSLVFGA
GGPETNTRRIVDAVRSGWLLAVPPGGTNVVDVRDVAAGLRAAMQKGETGRRYFLGGENLS
WRTLATTLADEFGVAPPRYTIPPSLLRVGGMLAEGVAALTRTQPVLARTTARTAARTYRY
DNSRARAELGCTFRPFAETARRVAAVLSGDAPTP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcccattctgttctcgtcaccggcgccaccggcttcgtcggctccgtcctc
acccgccagctcgtcgatgccgggaccgacgtgcgcatcttccggcgcgacacctcgtcc
ctcgacctcctgggcacgtacgccgagcgggtcgaccacgcggtgggcgacctccggcgg
gcccgaagcctgtacgaagcaatgcagggggtcgaccgggtctaccacgtggcggccaag
gtgagttttgcgcggggcgaccgggcggccgtccggcgcgtcaacgcggacggcacggcc
cacgtcgtcaacgccgccctgaaggccggggtcgaccggctcgtgcacacctccagcatc
gcggccctgggccgcccgccggagccggacggggcgattgacgagacgaccgagtggcag
ggcctgccccaccgctccgcctacgcccggtccaagcgccgggccgagctggaggtgcac
cgcggcatcgccgaagggctcgacgcgaccctcgtgaacccttcgctcgtctttggggcg
ggcgggcccgagaccaacacgcgccgcatcgtcgacgcggtgcgcagcggctggctgctc
gccgtgccgccgggcgggaccaacgtggtggacgtgcgtgacgtggcggcgggcctgcgg
gcggcgatgcagaagggcgagacgggccgtcgctacttcctagggggagagaacctgtcg
tggaggacgctcgccacgacgctcgcggacgaatttggggtggcgccgccccgctacacg
attccgccgtcgcttctacgagtcgggggcatgctggccgagggcgtcgccgccctcacc
cgcacgcagccggtcctcgcacgcaccacggcccgaaccgctgcccgcacctaccgctac
gacaacagccgtgcccgcgccgagcttgggtgcacgttccggccctttgcggagacggcc
cgacgcgtcgctgccgtgctgtccggggacgccccgacgccgtag

DBGET integrated database retrieval system