KEGG   Salinibacter ruber M8: SRM_01147Help
Entry
SRM_01147         CDS       T01209                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
srm  Salinibacter ruber M8
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRM_01147 (folK)
Enzymes [BR:srm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SRM_01147 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1317220..1317759
Genome map
AA seq 179 aa AA seqDB search
MGLGSNEGDRLEHLQRAAERLQQRDALTVVGVSPVYETEAHTTSPDETQPPFLNAVLRLT
VEADPRSLLRMAHAVEQAEGRTRTAEQRWGPRPLDVDLLAVGPLTRDTEALTLPHPRLAE
RRFVLRPWADLAPNFVVPPPFDRSVQSLLDQCTDPASIRRTDHTIGEGRASPEAPGTET
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttggggcttgggtccaacgagggcgaccgcctggagcacctgcagcgggcggccgagcgg
ttgcaacagcgcgacgccctcaccgtggtgggcgtttcccccgtgtacgagaccgaggcc
cacacgacctcgccggacgagacgcagcctccgtttttgaacgccgtgcttcggctgacc
gtcgaggccgacccgcgttccctcctccgaatggcgcacgcggtggagcaggcggagggg
cgcacccggaccgcggagcagcggtgggggccccgcccgctggacgtcgacctactggcg
gtcggacccctcacccgagacaccgaggccctcacgcttccccatccgcgccttgcggag
cgccggttcgtgctccgcccctgggccgacctcgcgccaaacttcgtcgtcccgccgccg
ttcgaccgctctgtgcaatcactgctcgatcagtgcacggatccggcttccattcgacgg
acggatcacacgattggggagggacgagcctcccctgaagcccccggtacggagacgtaa

DBGET integrated database retrieval system