KEGG   Salinibacter ruber M8: SRM_01211Help
Entry
SRM_01211         CDS       T01209                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
srm  Salinibacter ruber M8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:srm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1389922..1390944)
Genome map
AA seq 340 aa AA seqDB search
MASSDYDLLLRPRRLRKTRNIRRMARETRLSTDDLIAPLFVMAGDNQREEVPSMPDTYRH
TIDRLVDHAETLHALGIPAVALFPALPDHLKTPDAEHALDPDHLYPNAIRVLKDAVPELM
IITDTALDPYNSDGHDGIVRDGRIDNDATIQVMCEMAVLHAEAGADIIAPSDMMDGRVGA
LRAALDDAGHTDAAILSYTAKYSSNYYGPFRDALDSAPEDKAEAPEKDIPANKDTYQMDP
ANGEEAIRELMLDLDEGADMAMVKPALPYLDVIHRVQQHSDVPVAAYNVSGEYAMIKAAA
QNGWLDEKACALEALTGIRRAGADVILTYFAEDAARWLEE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttccgactacgaccttctcctccgcccccgtcgactgcgcaagacccgcaac
atccgacgcatggcgcgggagacacggctgtcgacggacgacctcattgcgcccctgttc
gtgatggcgggggacaatcagcgggaagaagtcccgtcgatgccggacacgtaccgtcac
acgatcgaccggctcgtcgaccacgcagagacgctgcatgcccttggcattccggcggtg
gccctgttcccggccctccccgatcacctgaagacgccggacgccgagcacgccctcgac
cctgatcacctctacccaaacgcgatccgggtcctcaaggacgccgtgccggaactgatg
atcatcaccgacacggccctcgatccctacaacagcgacgggcacgacggaatcgtgcgc
gacggccgcatcgacaacgacgcgaccattcaggtgatgtgcgaaatggcggtgctccac
gccgaggccggggccgacatcatcgccccatccgacatgatggacgggcgcgtgggcgcc
ctccgcgctgccctcgacgacgccgggcacaccgacgccgcaatcctgtcttacaccgcc
aagtactcgtcaaactactacggcccgttccgcgacgccctcgactcggcgcccgaggac
aaggcggaggcccctgagaaggacatccccgcgaacaaggacacctaccagatggacccg
gccaacggcgaggaggccatccgcgagctcatgctcgacctggacgagggcgccgacatg
gcaatggtgaagccggcgcttccctacctcgatgtcatccaccgcgtgcagcagcacagc
gacgtgcccgtcgccgcgtacaacgtgagcggcgagtacgccatgatcaaggccgccgcc
caaaacggctggctcgacgagaaggcctgtgcactggaggccctcaccggcattcgccgc
gccggggccgacgtcattctgacctacttcgcggaggacgcggcccgctggctggaagaa
tga

DBGET integrated database retrieval system