KEGG   Salinibacter ruber M8: SRM_01211Help
Entry
SRM_01211         CDS       T01209                                 

Gene name
hemB
Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
srm  Salinibacter ruber M8
Pathway
srm00860  Porphyrin and chlorophyll metabolism
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SRM_01211 (hemB)
Enzymes [BR:srm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SRM_01211 (hemB)
Exosome [BR:srm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SRM_01211 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CBH24132
UniProt: D5H7X7
Position
complement(1389922..1390944)
Genome map
AA seq 340 aa AA seqDB search
MASSDYDLLLRPRRLRKTRNIRRMARETRLSTDDLIAPLFVMAGDNQREEVPSMPDTYRH
TIDRLVDHAETLHALGIPAVALFPALPDHLKTPDAEHALDPDHLYPNAIRVLKDAVPELM
IITDTALDPYNSDGHDGIVRDGRIDNDATIQVMCEMAVLHAEAGADIIAPSDMMDGRVGA
LRAALDDAGHTDAAILSYTAKYSSNYYGPFRDALDSAPEDKAEAPEKDIPANKDTYQMDP
ANGEEAIRELMLDLDEGADMAMVKPALPYLDVIHRVQQHSDVPVAAYNVSGEYAMIKAAA
QNGWLDEKACALEALTGIRRAGADVILTYFAEDAARWLEE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttccgactacgaccttctcctccgcccccgtcgactgcgcaagacccgcaac
atccgacgcatggcgcgggagacacggctgtcgacggacgacctcattgcgcccctgttc
gtgatggcgggggacaatcagcgggaagaagtcccgtcgatgccggacacgtaccgtcac
acgatcgaccggctcgtcgaccacgcagagacgctgcatgcccttggcattccggcggtg
gccctgttcccggccctccccgatcacctgaagacgccggacgccgagcacgccctcgac
cctgatcacctctacccaaacgcgatccgggtcctcaaggacgccgtgccggaactgatg
atcatcaccgacacggccctcgatccctacaacagcgacgggcacgacggaatcgtgcgc
gacggccgcatcgacaacgacgcgaccattcaggtgatgtgcgaaatggcggtgctccac
gccgaggccggggccgacatcatcgccccatccgacatgatggacgggcgcgtgggcgcc
ctccgcgctgccctcgacgacgccgggcacaccgacgccgcaatcctgtcttacaccgcc
aagtactcgtcaaactactacggcccgttccgcgacgccctcgactcggcgcccgaggac
aaggcggaggcccctgagaaggacatccccgcgaacaaggacacctaccagatggacccg
gccaacggcgaggaggccatccgcgagctcatgctcgacctggacgagggcgccgacatg
gcaatggtgaagccggcgcttccctacctcgatgtcatccaccgcgtgcagcagcacagc
gacgtgcccgtcgccgcgtacaacgtgagcggcgagtacgccatgatcaaggccgccgcc
caaaacggctggctcgacgagaaggcctgtgcactggaggccctcaccggcattcgccgc
gccggggccgacgtcattctgacctacttcgcggaggacgcggcccgctggctggaagaa
tga

DBGET integrated database retrieval system