KEGG   Salinibacter ruber M8: SRM_01404Help
Entry
SRM_01404         CDS       T01209                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
srm  Salinibacter ruber M8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SRM_01404 (hemG)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SRM_01404 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1593534..1594919)
Genome map
AA seq 461 aa AA seqDB search
MPNVGIIGAGISGLAAAYRLQEHGHSVRVLEASGHTGGVIRSESSEGFLVEHGPNSIRAG
AAGLETLIDALDLHEDRVWANDAADTRYVVRDGRPTPLPRSVGSFLTTDLFSTRAKLRLL
AEPFIGRAAAEDESVARFTERRLGPEVLNYAVAPFVGGVFAGRPDDLSVQHAFRRLAALE
EESGSLLLGAIRRALTSDDGAPPDTPSGLFSFRNGLQTLPNALADTLGDRIRLNAPVHAL
THDGTAWRVTVSPPDAPAHTRSFDALVCTVPLHRLAAMEIDTPVDLAPLGEVTYPPLSVL
ALGYERDAIDHALDGFGMLVPPVEDTLDVLGTIFSSTLFPGRAPEGHVLLTTFVGGARAP
HHATSDAAALQARVARDLDSLLGVDASPVFRRLVHWPHAIPQYELGYGTVKDTFDALEAA
HPHLAFAGNYRAGVSVGDALTSGLEAADRLLETDERATQPH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgtcgggatcatcggagccggcatcagcggcctcgcggccgcgtaccgactt
caagagcacggccattcggttcgcgttctggaagcctccgggcacacggggggcgtgatc
cgctcggagtcgtcggagggcttcctggtggagcacggccccaactcgatccgggccggg
gccgccggtctggagacgctgatcgacgccctcgacctccacgaggaccgcgtctgggcc
aacgacgcggccgatacccggtacgtggtgcgcgacggccggcctacccccctgccccgc
tccgtcggctctttcctcacgaccgatttgttctcgacccgggcgaagttgcgcctcctg
gcggagcccttcatcggacgggccgcggcggaggacgagagcgtggcccggttcacggag
cggcgcctgggccccgaggtgctcaactatgccgtcgcccccttcgtggggggcgtgttc
gcggggaggcccgacgacctgtcggtccagcacgccttccgtcgcctcgccgcgctcgaa
gaagagtccggctccctcctcctcggcgcaatccgacgggccttgaccagcgacgacggt
gcccccccggacaccccgtcgggcctcttctccttccgcaacggcctgcagacgctcccc
aacgcactggccgacacgctcggcgaccgcatccgcctgaacgcccccgtccacgccctc
acgcacgacggcaccgcgtggcgggtgacggtctcgcccccggatgcccccgcacacacc
cgctccttcgacgccctcgtctgcaccgtgccgctccatcggctcgccgcgatggagatc
gacacccccgtcgatcttgccccccttggggaggtgacctatcccccgctgagtgtgctc
gccctcggctacgagcgagacgccatcgaccacgccctcgatggattcgggatgctcgtg
ccgccggtggaggacacgttggacgtcctcgggaccatcttttcctccacgctcttcccc
ggccgcgccccggaggggcacgtgcttctcaccaccttcgtcggcggcgcacgcgctccc
catcacgccacgtccgacgcggcggcccttcaggcccgcgtggcccgcgacctggattca
ctcctcggtgtggatgcgtcgccggtgtttcggcgcctcgtccactggccccacgccatt
ccgcagtacgagctcgggtacggaacggtcaaagacacatttgacgccctggaggcggcc
caccctcaccttgcctttgccggcaactaccgggcgggcgtatcggtgggcgatgcgctt
acctccggcctggaggcggccgaccgcctgctcgagacggacgagcgggccacgcagcct
cactga

DBGET integrated database retrieval system