KEGG   Salinibacter ruber M8: SRM_01441Help
Entry
SRM_01441         CDS       T01209                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
srm  Salinibacter ruber M8
Pathway
srm00330  Arginine and proline metabolism
srm00332  Carbapenem biosynthesis
srm01100  Metabolic pathways
srm01130  Biosynthesis of antibiotics
srm01230  Biosynthesis of amino acids
Module
srm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SRM_01441 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SRM_01441 (proB)
Enzymes [BR:srm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SRM_01441 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PUA AA_kinase
Motif
Other DBs
NCBI-ProteinID: CBH24362
UniProt: D5H8K7
Position
1634589..1635212
Genome map
AA seq 207 aa AA seqDB search
MICSDVDGLYTADPHDTPDAERLPAVDAITDEIYDMVGPSHRKVATGGMQTKVEAAEKAT
DRGIDTVLVNGTKGGHLDALGRGEMPGTLFRQAEQPLPARKHWMLHALPSAGRLTVDAGA
ADALRHEGASLLPSGIVAVEGRFARGDAVEIAVEKEGNWTRVAKGITQYGAADLERIQGR
QSHAIAEVLDEAPADYVVHRDDLVVEA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgatctgctcggacgtagacggcctctacaccgccgatccgcacgacaccccggacgcg
gagcgcctgccggcggtggacgccatcaccgacgagatctacgacatggtcgggccctcc
caccgcaaggtggccaccggcggcatgcagacgaaggtggaggcggcagaaaaagcgacg
gaccgcgggatcgataccgttctggtcaacggaaccaaaggcggccacctcgacgcgctg
gggcgcggtgagatgccgggcacgctctttcggcaggccgagcagccgcttcccgcgcgc
aagcactggatgctccacgcgcttccctcagcgggccgcctgacggtcgacgccggggcg
gccgacgcactgcgacacgagggcgcttcgttgttgccgtcgggcattgtggcggtggag
ggccgctttgcccggggcgacgccgtggagattgcggtcgagaaagaggggaactggacc
cgcgtggcgaagggcatcacgcagtacggggccgccgacctggagcgcatccaggggcga
cagagccacgccatcgccgaggtcctcgacgaggcgcccgccgactacgtggtgcaccgc
gacgatctggtggtggaggcgtga

DBGET integrated database retrieval system