KEGG   Salinibacter ruber M8: SRM_01520Help
Entry
SRM_01520         CDS       T01209                                 

Gene name
hal2
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
srm  Salinibacter ruber M8
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SRM_01520 (hal2)
Enzymes [BR:srm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SRM_01520 (hal2)
Transfer RNA biogenesis [BR:srm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SRM_01520 (hal2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1733775..1734776)
Genome map
AA seq 333 aa AA seqDB search
MPAYDRERTVAFRAVQTAAELCQSVRADLDGDVMEKDDRTPVTVADFGSQAVICKALRDA
FPDDPVIGEEDSSALRADANADVRAHLLEEVRAHHPDVNPGLVFDWIDHGTDAGYSERFW
TLDPIDGTKGFVRGDQYAIALALIVDGRPQVAALCCPHLPSAIDADPPASRGQAFLAVRG
EGTVQQPLTPDTDAVPTPIQTSGTTDPSESRFCESFVSSHSSHDLAAQAGERLGITADSI
RIDSQAKYAIVARGEADIYLRLPRPDSPDYTERIWDHAAGALAVEAAGGTVTDMHGTPLD
FTHGRLLEANTGVVATNGPVHDEVIEALAAAQA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcctacgaccgcgaacgcaccgtcgccttccgtgccgttcagaccgccgccgaa
ttgtgccagtccgtccgggctgacctcgacggggacgtgatggaaaaggacgaccgcacg
cccgtcaccgtggccgacttcggcagccaggccgtcatttgcaaggcgctccgggacgcc
tttccggacgatcccgtcatcggcgaggaagacagctcggccctgcgggccgacgcgaac
gccgacgtacgggcccacctcctggaagaggtgcgcgcccaccacccggacgtcaatcca
ggactggtgttcgactggattgaccacggcaccgacgcgggctacagcgagcgcttctgg
acgctcgatccgattgacggaaccaagggcttcgtgcggggcgaccagtacgcgatcgcg
ctcgccctgatcgtggacggccgcccccaggtggcggccctgtgctgcccgcaccttccc
agtgccatcgacgccgatccgcccgcctcgcggggccaggcgttcctggccgttcggggc
gaggggaccgtacaacagccgctcacgccggacaccgacgcggtgcccaccccgatccag
accagcggcacgaccgacccgtcggagagccgattctgcgagtcgttcgtttcctcgcac
agctcccacgatctcgccgcgcaggcgggggaacgcctcggcatcacggccgactccatc
cggatcgacagccaggcgaagtacgccatcgtcgcgcggggcgaggcggacatctacctg
cgcctcccgcggccggacagccccgactacaccgagcgcatctgggaccacgcggccggg
gcgctcgcggtggaggctgccgggggcaccgtgacggacatgcacggcacccccctcgac
ttcacccacggccgcctgctggaggccaacacgggcgtcgtcgctaccaacgggcccgtc
cacgatgaggtcatcgaggccctggctgccgcccaggcgtga

DBGET integrated database retrieval system