KEGG   Salinibacter ruber M8: SRM_01648Help
Entry
SRM_01648         CDS       T01209                                 

Gene name
pncA
Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
srm  Salinibacter ruber M8
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:srm00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1878343..1878969
Genome map
AA seq 208 aa AA seqDB search
MDALLIVDLQNDFCPGGALAVPEGDTIVPTVNALAARFDHVIQTQDWHPAGHQSFASSHP
DHAPMDVIEVDYGEQVLWPDHCVQGTEGAEFHPDLDTAPSELILRKGFRPGIDSYSAFYE
NDGTTPTGLMGYLRERGIDTLYLCGLATDFCVKWSAVDGREEGFDVYVIEDATRGIDQDG
SLAQAWDEMNEAGVQVISSEAALDLAAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacgcactcctcatcgtcgaccttcagaacgacttttgccccggcggcgccctggcg
gtgccggagggggacaccatcgtcccgaccgtgaatgcgctggccgcccggttcgaccac
gtcatccagacccaggactggcacccggccgggcaccagtcgttcgcctcgtcgcacccg
gaccacgccccgatggacgtgattgaggtggactacggcgagcaggtgctgtggccggac
cactgcgtccagggcaccgagggggccgagtttcacccggacctcgacaccgccccgtcg
gagctgatcctccgcaaggggttccggcccggaatcgactcctactccgccttctacgaa
aacgacggcacaacgccgaccggcttgatgggctacctgcgggagcggggcatcgacacg
ctctacctgtgcggcctcgccacggacttctgcgtgaagtggtcggccgtcgacgggcgc
gaggaggggttcgacgtgtacgtgatcgaggacgcgacccgcggcatcgaccaggacggc
tcgctggcgcaggcctgggacgagatgaacgaggcgggcgtccaggtcatctcctcggaa
gccgcgctcgacctggccgcggcgtaa

DBGET integrated database retrieval system