KEGG   Salinibacter ruber M8: SRM_01651Help
Entry
SRM_01651         CDS       T01209                                 

Gene name
fadJ
Definition
fatty acid oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
srm  Salinibacter ruber M8
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRM_01651 (fadJ)
   01212 Fatty acid metabolism
    SRM_01651 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SRM_01651 (fadJ)
   00650 Butanoate metabolism
    SRM_01651 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SRM_01651 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    SRM_01651 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SRM_01651 (fadJ)
   00310 Lysine degradation
    SRM_01651 (fadJ)
   00380 Tryptophan metabolism
    SRM_01651 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SRM_01651 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SRM_01651 (fadJ)
   00281 Geraniol degradation
    SRM_01651 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SRM_01651 (fadJ)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SRM_01651 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SRM_01651 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SRM_01651 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1880599..1882758)
Genome map
AA seq 719 aa AA seqDB search
MPNALSVPTDLLTLTVDETGVATLALDAPDASVNKISWDTLNAFSDALDVVETHADLSGL
VIASGKPDSFIVGADLAMLQTFEIPAEARRLSREAHALGERVRSLPVPTVAALHGPVMGG
GLELALNCDYRVASTADATKMALPEVQLGLLPGGGGTQLLPRLVGVQQALGLMLTGKNTY
PDKARRIGLVDALIHPPGLRHAARRAARELAAGTRTVERAEQSLGDRLLEGNPVSRRVIY
RQARTRTERRTRGNYPAPPRIIDAVRTGMEEGLEAGLDTERQHFGELVFTPESQALVSIF
FAKRDAETNPQPEQARPVDTVGVLGAGLMGSGIAQVSAQNGLDVVLTDQSLALAAEGKKA
IWSAVTEQEDKGIINTFTRDQIVERVAPTADYAPLQAADVVIEAVPEDLSIKHAVLSEIE
TVVDADTVLASNTSALPISTIAEGVDDPSRVLGMHYFSPVPDIPLLEIVVTEETSDEALA
TAYAAGLAQDKTVIVVNDGPGFYTTRILALYMNEALLLFEAGAEIEAVDEAMTDAGFPMG
PFELFDLVGLDVAAKITDVMGEALSPERVDISDRAGRLAEADLLGQKTNRGFYEYDADDD
ADDKDPQGVNDAVYRHRDASSRSTPPAGTIQDRLLLMMVNEAVRCLEDEVLRAPIDGDLG
AVFGLGFPPFLGGPFRHVDRAGAASIVDTLQRLADRHGPRFAPADRLQTHAAQDTTFHS
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgccctctctgtgcccacggacctcctgaccctgacggtcgacgagaccgga
gtggccacgctcgcgctcgatgcccccgacgcgtcggtcaacaagatctcttgggacacc
ctgaacgcgttttccgacgccctggacgtggttgagacccacgccgacctgtccgggctg
gtgatcgccagcggcaagccggactcgttcatcgtcggggccgacctggcgatgctgcaa
acgttcgagatcccggcggaggcgcggcgcctaagccgcgaggcccacgccctcggggag
cgggtccgaagcctcccggtcccgaccgtggccgccctccatggcccggtgatggggggc
ggcctggagctggcgctcaactgcgactaccgcgtcgcctccaccgccgacgcgaccaag
atggccctgccggaggtgcagctcggccttctgcccggcgggggcggcacccagctgctg
ccgcgcctcgtgggcgtgcagcaggccctcgggctcatgctgaccggaaaaaacacgtac
ccggacaaggcgcggcgcatcggcctggtcgacgccctcatccacccgcccggcctccgc
catgcggcgcggcgggcggcccgtgagctggcggcgggcacccgcaccgtcgagcgtgcc
gagcagtcgctcggggaccgcctgctggagggcaaccccgtcagccggcgcgtcatctac
cggcaggcccgcacacggaccgagcgccgcacccggggcaactaccccgccccgccccgc
atcatcgacgcggtgcgcacggggatggaggagggcctggaggcggggctcgacacggag
cggcagcacttcggcgagctcgtgttcacgcccgagtcgcaggccctcgtgtcgatcttc
ttcgccaagcgggacgcggagacgaacccgcagcccgaacaggcgcgcccggtcgatacc
gtgggcgtgctcggggcgggcctcatgggcagtggcatcgcgcaggtgtcggcccagaac
gggctcgacgtcgtgcttacggaccagtcgctggcgctcgcggccgaggggaagaaggcc
atctggtccgcggtgaccgagcaggaggacaagggcatcattaacacgttcacgcgggac
cagattgtagagcgggtcgcccccaccgccgactacgcgcccctccaggcggccgacgtc
gtgattgaagccgtgccggaggacctgtcgatcaagcacgcggtgctgtcggagatagag
acggtcgtcgacgcggacacggtgctggcctccaacacctccgccctccccatctcgacg
atcgccgagggcgtggacgacccgtcccgcgtgctggggatgcactacttctcccccgtc
cccgacatcccactgctggagatcgtcgtcaccgaggagacctccgacgaggcactggcc
accgcctacgccgccggcctcgcgcaggacaagaccgtcatcgtggtgaacgacggcccg
ggcttttacaccactcgcatcctcgccctctacatgaacgaggccctgctgctcttcgag
gccggggccgagatcgaggcggtcgacgaggcgatgacggacgccgggttcccgatgggc
ccgttcgagctgttcgacctggtgggcctggacgtggcggccaaaattacggacgtgatg
ggcgaggccctctcgccggaacgcgtcgacatcagcgaccgggccggccggctcgcggag
gccgacctgctgggccaaaagaccaaccgcggcttctacgagtacgacgcggatgacgac
gccgacgacaaagacccgcagggcgtcaacgacgccgtgtaccggcaccgcgatgcctcg
tcccgatcaaccccgcccgccggcacgatccaggaccgcctgcttctcatgatggtcaac
gaggccgtccggtgcctcgaagacgaggtgctccgcgcccccatcgacggcgacctcggg
gccgtgtttgggctcggctttccgcccttcctcggcgggcccttccgccacgtcgaccgt
gcaggggccgcctccatcgtggacaccctccagcgcctggccgaccggcacggccctcgc
tttgccccggccgaccgcctccagacccacgccgctcaggacaccacctttcactcgtaa

DBGET integrated database retrieval system