KEGG   Salinibacter ruber M8: SRM_01651Help
Entry
SRM_01651         CDS       T01209                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
srm  Salinibacter ruber M8
Pathway
srm00071  Fatty acid degradation
srm00280  Valine, leucine and isoleucine degradation
srm00281  Geraniol degradation
srm00310  Lysine degradation
srm00362  Benzoate degradation
srm00380  Tryptophan metabolism
srm00410  beta-Alanine metabolism
srm00640  Propanoate metabolism
srm00650  Butanoate metabolism
srm00903  Limonene and pinene degradation
srm00930  Caprolactam degradation
srm01040  Biosynthesis of unsaturated fatty acids
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
srm01130  Biosynthesis of antibiotics
srm01200  Carbon metabolism
srm01212  Fatty acid metabolism
Module
srm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SRM_01651 (fadJ)
   00650 Butanoate metabolism
    SRM_01651 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SRM_01651 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    SRM_01651 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SRM_01651 (fadJ)
   00310 Lysine degradation
    SRM_01651 (fadJ)
   00380 Tryptophan metabolism
    SRM_01651 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SRM_01651 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SRM_01651 (fadJ)
   00281 Geraniol degradation
    SRM_01651 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SRM_01651 (fadJ)
   00930 Caprolactam degradation
    SRM_01651 (fadJ)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SRM_01651 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SRM_01651 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SRM_01651 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DFP NAD_Gly3P_dh_N HisG F420_oxidored UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: CBH24572
UniProt: D5H967
Position
complement(1880599..1882758)
Genome map
AA seq 719 aa AA seqDB search
MPNALSVPTDLLTLTVDETGVATLALDAPDASVNKISWDTLNAFSDALDVVETHADLSGL
VIASGKPDSFIVGADLAMLQTFEIPAEARRLSREAHALGERVRSLPVPTVAALHGPVMGG
GLELALNCDYRVASTADATKMALPEVQLGLLPGGGGTQLLPRLVGVQQALGLMLTGKNTY
PDKARRIGLVDALIHPPGLRHAARRAARELAAGTRTVERAEQSLGDRLLEGNPVSRRVIY
RQARTRTERRTRGNYPAPPRIIDAVRTGMEEGLEAGLDTERQHFGELVFTPESQALVSIF
FAKRDAETNPQPEQARPVDTVGVLGAGLMGSGIAQVSAQNGLDVVLTDQSLALAAEGKKA
IWSAVTEQEDKGIINTFTRDQIVERVAPTADYAPLQAADVVIEAVPEDLSIKHAVLSEIE
TVVDADTVLASNTSALPISTIAEGVDDPSRVLGMHYFSPVPDIPLLEIVVTEETSDEALA
TAYAAGLAQDKTVIVVNDGPGFYTTRILALYMNEALLLFEAGAEIEAVDEAMTDAGFPMG
PFELFDLVGLDVAAKITDVMGEALSPERVDISDRAGRLAEADLLGQKTNRGFYEYDADDD
ADDKDPQGVNDAVYRHRDASSRSTPPAGTIQDRLLLMMVNEAVRCLEDEVLRAPIDGDLG
AVFGLGFPPFLGGPFRHVDRAGAASIVDTLQRLADRHGPRFAPADRLQTHAAQDTTFHS
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgccctctctgtgcccacggacctcctgaccctgacggtcgacgagaccgga
gtggccacgctcgcgctcgatgcccccgacgcgtcggtcaacaagatctcttgggacacc
ctgaacgcgttttccgacgccctggacgtggttgagacccacgccgacctgtccgggctg
gtgatcgccagcggcaagccggactcgttcatcgtcggggccgacctggcgatgctgcaa
acgttcgagatcccggcggaggcgcggcgcctaagccgcgaggcccacgccctcggggag
cgggtccgaagcctcccggtcccgaccgtggccgccctccatggcccggtgatggggggc
ggcctggagctggcgctcaactgcgactaccgcgtcgcctccaccgccgacgcgaccaag
atggccctgccggaggtgcagctcggccttctgcccggcgggggcggcacccagctgctg
ccgcgcctcgtgggcgtgcagcaggccctcgggctcatgctgaccggaaaaaacacgtac
ccggacaaggcgcggcgcatcggcctggtcgacgccctcatccacccgcccggcctccgc
catgcggcgcggcgggcggcccgtgagctggcggcgggcacccgcaccgtcgagcgtgcc
gagcagtcgctcggggaccgcctgctggagggcaaccccgtcagccggcgcgtcatctac
cggcaggcccgcacacggaccgagcgccgcacccggggcaactaccccgccccgccccgc
atcatcgacgcggtgcgcacggggatggaggagggcctggaggcggggctcgacacggag
cggcagcacttcggcgagctcgtgttcacgcccgagtcgcaggccctcgtgtcgatcttc
ttcgccaagcgggacgcggagacgaacccgcagcccgaacaggcgcgcccggtcgatacc
gtgggcgtgctcggggcgggcctcatgggcagtggcatcgcgcaggtgtcggcccagaac
gggctcgacgtcgtgcttacggaccagtcgctggcgctcgcggccgaggggaagaaggcc
atctggtccgcggtgaccgagcaggaggacaagggcatcattaacacgttcacgcgggac
cagattgtagagcgggtcgcccccaccgccgactacgcgcccctccaggcggccgacgtc
gtgattgaagccgtgccggaggacctgtcgatcaagcacgcggtgctgtcggagatagag
acggtcgtcgacgcggacacggtgctggcctccaacacctccgccctccccatctcgacg
atcgccgagggcgtggacgacccgtcccgcgtgctggggatgcactacttctcccccgtc
cccgacatcccactgctggagatcgtcgtcaccgaggagacctccgacgaggcactggcc
accgcctacgccgccggcctcgcgcaggacaagaccgtcatcgtggtgaacgacggcccg
ggcttttacaccactcgcatcctcgccctctacatgaacgaggccctgctgctcttcgag
gccggggccgagatcgaggcggtcgacgaggcgatgacggacgccgggttcccgatgggc
ccgttcgagctgttcgacctggtgggcctggacgtggcggccaaaattacggacgtgatg
ggcgaggccctctcgccggaacgcgtcgacatcagcgaccgggccggccggctcgcggag
gccgacctgctgggccaaaagaccaaccgcggcttctacgagtacgacgcggatgacgac
gccgacgacaaagacccgcagggcgtcaacgacgccgtgtaccggcaccgcgatgcctcg
tcccgatcaaccccgcccgccggcacgatccaggaccgcctgcttctcatgatggtcaac
gaggccgtccggtgcctcgaagacgaggtgctccgcgcccccatcgacggcgacctcggg
gccgtgtttgggctcggctttccgcccttcctcggcgggcccttccgccacgtcgaccgt
gcaggggccgcctccatcgtggacaccctccagcgcctggccgaccggcacggccctcgc
tttgccccggccgaccgcctccagacccacgccgctcaggacaccacctttcactcgtaa

DBGET integrated database retrieval system