KEGG   Salinibacter ruber M8: SRM_01664Help
Entry
SRM_01664         CDS       T01209                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
srm  Salinibacter ruber M8
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SRM_01664 (glpK)
Enzymes [BR:srm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SRM_01664 (glpK)
Exosome [BR:srm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SRM_01664 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1897470..1899050)
Genome map
AA seq 526 aa AA seqDB search
MQYILALDQGTTSSRSILFDTQGQVQTVAQKEFEQHYPQPGWVEHDANEIWSTQMGTASE
AMSRANVEAEDLAAIGITNQRETTVVWDRATGTPIHNAIVWQDRRTSGLCDRLKDRGHLD
LIQEKTGLIIDAYFSGTKIKWLLDNVDGARERAENGELAFGTVDSWLVWRMTNGKRHVTD
ATNASRTLLYNIHEGAWDPELLDILDIPPSMLPDVRDSSEVYGTTQGGPFDEEVPIAGIA
GDQQAALFGQMCTTPGLGKNTYGTGAFLLQNTGETAVTSEHNLLTTIAYQIDGTTYYALE
GSIFVAGAVVQWLRDELKMIREAAEVERLARTVDDNGGVYFVPAFTGLGAPYWDQYARGT
ISGLTRGANRGHLARAAIESMAYQVADVIDAMEADSGIETTELGADGGAAANDLLLQFQS
DILDIPVVRPKILETTALGAAYLAGLAVGYWDSQSEIQDQWELDQMFTPSMPKDRVETLR
TGWSKALDRARAWESPDSSEAAPQAADVSTNATSTAPAGEESPAAS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacatactcgcgctcgatcaggggacgacgagctcgcggtccatcctgttcgac
actcaggggcaggtacaaaccgtagcccagaaggagttcgagcagcattatccacagccc
ggatgggtggagcacgacgcgaacgaaatctggtcgacccagatggggaccgcgtcggag
gccatgagccgggcgaacgtcgaggcggaggacctggcggccatcggcatcaccaaccag
cgcgagacgacggttgtctgggaccgcgccaccggcacccccatccacaacgccattgtc
tggcaggaccgacggacctcggggctctgcgaccgactcaaggaccgggggcacctggac
ctcatccaggagaaaacggggctcatcatcgacgcctacttttccgggacgaagatcaag
tggctgctggacaacgtggacggggcccgcgagcgcgcagagaatggggagctggccttc
ggcacagtcgatagctggctcgtctggcgcatgacgaacggcaagcgccacgtcaccgat
gccaccaacgcctcccggaccctcctctacaacatccacgagggagcgtgggacccagag
ctgctcgatattctcgacatccccccgtccatgctgcccgacgtgcgggacagcagcgaa
gtgtacggcacgacgcagggcggcccgttcgacgaggaggtgcccatcgcgggcatcgcg
ggggaccagcaggccgcgctgtttgggcagatgtgcaccacgcccggcctcggcaaaaac
acctacggcacgggcgcctttctgctccagaataccggcgagacggcggtcacctccgag
cacaacctgctcaccacgatcgcctaccagatcgacggcaccacctactacgccctggag
ggctccatcttcgtcgccggggcggtggtgcagtggctgcgcgacgagctcaagatgatt
cgggaggccgcggaggtcgagcggctcgcccgcactgtcgacgacaacggcggcgtctat
ttcgtgcccgccttcaccggcctcggcgccccgtactgggaccagtacgcccgcggcacg
atcagcgggctcacgcggggggccaaccgcgggcacctcgcccgggccgccatcgagagc
atggcctaccaggtggccgacgtcatcgacgcgatggaggccgactccggcatcgagacg
acggagctgggggccgacggcggggccgcggccaacgacctgctgctgcagttccagtcc
gacattctcgacatcccggtggtccgtcccaagatcctcgaaaccaccgccctgggggcg
gcctacctcgcgggcctcgccgtcggctactgggacagccagtccgagattcaggaccag
tgggagctggaccagatgtttaccccgtcgatgccgaaagaccgcgtcgaaacgctccga
accggctggtcgaaggccctggaccgcgctcgggcctgggagtcgcccgactccagtgag
gccgcgccccaggccgccgacgtctcgaccaatgcgacctccaccgcccccgcaggcgag
gaatccccggccgcctcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system