KEGG   Salinibacter ruber M8: SRM_01751Help
Entry
SRM_01751         CDS       T01209                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
srm  Salinibacter ruber M8
Pathway
srm00860  Porphyrin and chlorophyll metabolism
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
Module
srm_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SRM_01751 (hemD)
Enzymes [BR:srm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SRM_01751 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CBH24672
UniProt: D5H9G7
Position
complement(2000922..2001665)
Genome map
AA seq 247 aa AA seqDB search
MSAAPDVILLRSADDEAPDRYRAAFREAGLRAVCEPVLAFTFPRQAKLRDRLAAPDPYAG
LLATSPRATVALEQVFASHEALADGWADRLAYAVGPKTAARLRALGLRARGDDTGTADAL
AARIVKDDPDAPLLFLSGNRRRETLPEALRAAEVRFDELVVYETHARTDLDVPARGRASW
LVFFSPSGLEAVTRAEGVDVQAHRLAAIGPTTAEALEGDGHAVEAVADEPSPDGLVAALQ
RAGARSS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgctcccgacgtcatccttctccggtcggcggacgatgaggccccggaccgg
taccgggccgcctttcgcgaggcggggctgcgggcggtctgcgagcctgtgctcgccttc
acgttcccccgacaggcaaagctccgcgaccggctggccgcacccgacccgtacgcgggg
ctcctcgccaccagtccgcgggccactgtcgccctcgaacaggtgtttgcgtcccacgaa
gcactcgcggacggatgggcggaccgcctggcgtacgcggtggggccgaaaaccgcggcc
cgcctgcgggcgctggggctccgtgcccgcggggacgatacaggcactgcggacgccctg
gcggcgcgcatcgtcaaggacgatccggacgcgcccctgctcttcctgtccgggaatcga
cggcgtgagacgttgccggaggccctgcgggccgcggaggtccgtttcgacgagctggtg
gtgtacgagacgcacgcccgcactgatctcgacgtgccggcgcgggggagggcgtcctgg
ctcgtctttttcagcccgtccggcttggaagcggtgacccgcgcggagggggtagacgtg
caggcccatcggctcgcggccatcgggccgaccacggcggaggccctagagggcgacggg
cacgccgtggaggcggtggcggacgagccgtccccggatggactcgtggcggcccttcag
agggcaggcgcgcgttcctcctga

DBGET integrated database retrieval system