KEGG   Salinibacter ruber M8: SRM_01751Help
Entry
SRM_01751         CDS       T01209                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
srm  Salinibacter ruber M8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:srm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2000922..2001665)
Genome map
AA seq 247 aa AA seqDB search
MSAAPDVILLRSADDEAPDRYRAAFREAGLRAVCEPVLAFTFPRQAKLRDRLAAPDPYAG
LLATSPRATVALEQVFASHEALADGWADRLAYAVGPKTAARLRALGLRARGDDTGTADAL
AARIVKDDPDAPLLFLSGNRRRETLPEALRAAEVRFDELVVYETHARTDLDVPARGRASW
LVFFSPSGLEAVTRAEGVDVQAHRLAAIGPTTAEALEGDGHAVEAVADEPSPDGLVAALQ
RAGARSS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgctcccgacgtcatccttctccggtcggcggacgatgaggccccggaccgg
taccgggccgcctttcgcgaggcggggctgcgggcggtctgcgagcctgtgctcgccttc
acgttcccccgacaggcaaagctccgcgaccggctggccgcacccgacccgtacgcgggg
ctcctcgccaccagtccgcgggccactgtcgccctcgaacaggtgtttgcgtcccacgaa
gcactcgcggacggatgggcggaccgcctggcgtacgcggtggggccgaaaaccgcggcc
cgcctgcgggcgctggggctccgtgcccgcggggacgatacaggcactgcggacgccctg
gcggcgcgcatcgtcaaggacgatccggacgcgcccctgctcttcctgtccgggaatcga
cggcgtgagacgttgccggaggccctgcgggccgcggaggtccgtttcgacgagctggtg
gtgtacgagacgcacgcccgcactgatctcgacgtgccggcgcgggggagggcgtcctgg
ctcgtctttttcagcccgtccggcttggaagcggtgacccgcgcggagggggtagacgtg
caggcccatcggctcgcggccatcgggccgaccacggcggaggccctagagggcgacggg
cacgccgtggaggcggtggcggacgagccgtccccggatggactcgtggcggcccttcag
agggcaggcgcgcgttcctcctga

DBGET integrated database retrieval system