KEGG   Salinibacter ruber M8: SRM_01874Help
Entry
SRM_01874         CDS       T01209                                 

Gene name
trpB2
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
srm  Salinibacter ruber M8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SRM_01874 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRM_01874 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SRM_01874 (trpB2)
Enzymes [BR:srm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SRM_01874 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2137649..2138887
Genome map
AA seq 412 aa AA seqDB search
MQELPAMSSPATTSRADTLPDTDGHFGSYGGAFVPETLTPVLEELKAAYDTYKDDPDFQA
DLRALLREYAGRPTPLSYCDRLTERIGGARIYAKREDLCHTGAHKINNTLGQILLATRMG
KERIIAETGAGQHGVATATVCAKFGVDCVIYMGAEDMERQRLNVERMELLGAEVRAATSG
SQTLKEATNEAIRDWVSNPDDTFYIIGSVVGPHPYPMMVRNFHRVIGTETRRQLREETGR
ETPDAIAACVGGGSNAIGIFHPFLDDPEVQLHGTEAAGGGLDGDHAATLAEGSPGVLHGA
MSYLLQDDAGQVSLAHSLSAGLDYPGVGPEHAHLRDEGRVSYHPVTDDEALDGVELLSQT
EGIIPALETAHAVALLPELARTLAEERGDDAVLVFNCSGRGDKDMQTIAAHR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ctgcaagagttgcccgccatgtcctctcccgctaccacgtctcgtgcggacaccctcccc
gataccgatggccacttcggctcgtacgggggagcgttcgtgccggagaccctcacccct
gtactggaggagctgaaggccgcctacgacacgtataaggacgacccggacttccaggcc
gacctccgcgccctcctccgtgaatacgccgggcggcccacccccctctcctactgcgac
cgcctgaccgaacggatcggcggggcccgcatctacgcgaagcgggaagacctttgccac
accggggcccacaaaattaacaacacgctcggccagatcctgctggcgacgcgcatgggc
aaggagcgcatcattgccgaaaccggggccgggcagcacggggtggccaccgccacggtc
tgcgccaagttcggcgtcgactgcgtgatttacatgggggcggaggacatggaacgccag
cgcctcaacgtggagcgcatggagctgctgggcgcggaggttcgggcggcgacctcgggc
agccaaaccctgaaggaggccaccaacgaggccattcgggactgggtgtccaacccggac
gacacgttctacatcatcggctccgtcgtgggcccgcacccctatcccatgatggtgcgc
aactttcaccgggtgatcggcaccgagacgcgtcgccagctccgtgaggagaccggccgg
gagacgccggacgccatcgcggcctgcgtggggggcggctccaacgccatcggcatcttc
catccgttcctcgacgaccccgaggtgcaactgcacgggacggaggcggcgggcggcggc
ctcgacggcgaccacgcggccacccttgccgagggatcgccgggcgtcctgcacggggcg
atgagctacctcctgcaggacgacgccggtcaggtgagcctcgcccactcgctctccgcc
ggcctcgactaccccggcgtggggcccgagcacgcccacctgcgcgacgagggacgcgtc
tcgtaccacccggtgaccgacgacgaggccctggacggggtggagcttctctcccaaacg
gaaggcatcatcccggcgctcgaaacggcgcacgccgtcgccctcctgcccgagctggcg
cgcaccctggccgaggagcgcggggacgacgccgtcctcgtctttaactgctccggccgg
ggcgacaaggacatgcagaccatcgccgcacaccggtaa

DBGET integrated database retrieval system