KEGG   Salinibacter ruber M8: SRM_01874Help
Entry
SRM_01874         CDS       T01209                                 

Gene name
trpB2
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
srm  Salinibacter ruber M8
Pathway
srm00260  Glycine, serine and threonine metabolism
srm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01130  Biosynthesis of antibiotics
srm01230  Biosynthesis of amino acids
Module
srm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRM_01874 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SRM_01874 (trpB2)
Enzymes [BR:srm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SRM_01874 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBH24795
UniProt: D5H9U0
Position
2137649..2138887
Genome map
AA seq 412 aa AA seqDB search
MQELPAMSSPATTSRADTLPDTDGHFGSYGGAFVPETLTPVLEELKAAYDTYKDDPDFQA
DLRALLREYAGRPTPLSYCDRLTERIGGARIYAKREDLCHTGAHKINNTLGQILLATRMG
KERIIAETGAGQHGVATATVCAKFGVDCVIYMGAEDMERQRLNVERMELLGAEVRAATSG
SQTLKEATNEAIRDWVSNPDDTFYIIGSVVGPHPYPMMVRNFHRVIGTETRRQLREETGR
ETPDAIAACVGGGSNAIGIFHPFLDDPEVQLHGTEAAGGGLDGDHAATLAEGSPGVLHGA
MSYLLQDDAGQVSLAHSLSAGLDYPGVGPEHAHLRDEGRVSYHPVTDDEALDGVELLSQT
EGIIPALETAHAVALLPELARTLAEERGDDAVLVFNCSGRGDKDMQTIAAHR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ctgcaagagttgcccgccatgtcctctcccgctaccacgtctcgtgcggacaccctcccc
gataccgatggccacttcggctcgtacgggggagcgttcgtgccggagaccctcacccct
gtactggaggagctgaaggccgcctacgacacgtataaggacgacccggacttccaggcc
gacctccgcgccctcctccgtgaatacgccgggcggcccacccccctctcctactgcgac
cgcctgaccgaacggatcggcggggcccgcatctacgcgaagcgggaagacctttgccac
accggggcccacaaaattaacaacacgctcggccagatcctgctggcgacgcgcatgggc
aaggagcgcatcattgccgaaaccggggccgggcagcacggggtggccaccgccacggtc
tgcgccaagttcggcgtcgactgcgtgatttacatgggggcggaggacatggaacgccag
cgcctcaacgtggagcgcatggagctgctgggcgcggaggttcgggcggcgacctcgggc
agccaaaccctgaaggaggccaccaacgaggccattcgggactgggtgtccaacccggac
gacacgttctacatcatcggctccgtcgtgggcccgcacccctatcccatgatggtgcgc
aactttcaccgggtgatcggcaccgagacgcgtcgccagctccgtgaggagaccggccgg
gagacgccggacgccatcgcggcctgcgtggggggcggctccaacgccatcggcatcttc
catccgttcctcgacgaccccgaggtgcaactgcacgggacggaggcggcgggcggcggc
ctcgacggcgaccacgcggccacccttgccgagggatcgccgggcgtcctgcacggggcg
atgagctacctcctgcaggacgacgccggtcaggtgagcctcgcccactcgctctccgcc
ggcctcgactaccccggcgtggggcccgagcacgcccacctgcgcgacgagggacgcgtc
tcgtaccacccggtgaccgacgacgaggccctggacggggtggagcttctctcccaaacg
gaaggcatcatcccggcgctcgaaacggcgcacgccgtcgccctcctgcccgagctggcg
cgcaccctggccgaggagcgcggggacgacgccgtcctcgtctttaactgctccggccgg
ggcgacaaggacatgcagaccatcgccgcacaccggtaa

DBGET integrated database retrieval system