KEGG   Salinibacter ruber M8: SRM_01875Help
Entry
SRM_01875         CDS       T01209                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
srm  Salinibacter ruber M8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SRM_01875 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRM_01875 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SRM_01875 (trpA)
Enzymes [BR:srm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SRM_01875 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2138940..2139779
Genome map
AA seq 279 aa AA seqDB search
MSRLDETFDALGPDEKAMGLFLTDGFPNPDATVPLLHAIDRGGADFIELGMPFSDPLAEG
RPIQRASARALSHGVTLPDTLRTVEAFREDSDTPLLLMGYVNPVFKYGVDAFCRDAAEAG
VDGLILPDLPPQESDALCDAAAAHGLELVFLIAPNTSDERIRVVDERATGFVYAVSVTGL
TGSDLAETPSVDEYLMHARDFVAQNPLLLVGFGIKTHDDAMELSRHTDGFIVGSALINRV
EALWEDPERSTTDRLDTVEGFARHLKSGTPVPTPQPNPA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgactcgacgagacgttcgatgccctcggccccgacgaaaaggccatggggctc
ttcctcacggacgggtttccgaatcccgacgcgaccgtccccctgctccacgcgatcgat
cgcgggggggccgacttcatcgagctgggcatgcccttcagcgatccactggccgaaggg
cgtcccatccagcgggccagcgcccgggccctctcccacggggtcacactgcccgacacc
ctccggaccgtcgaggcgtttcgggaggacagcgacacgcccctcctgttgatgggctac
gtcaacccggtgttcaagtacggggtcgatgccttctgccgggacgcggcggaagccggc
gtcgacggcctcatcctgccggacctgcccccgcaggagagcgacgcgctctgcgacgcg
gccgccgcccacggcctggagctggtcttcctgatcgctcccaacacctccgacgaacgg
attcgggtcgtcgacgagcgggccacgggcttcgtctacgccgtgagcgtaaccggcctc
acgggcagcgacctggccgagacgccgagcgtagacgagtatctgatgcacgcccgagat
tttgtggcacaaaaccccctcctcctcgtcggcttcggcatcaagacccacgacgacgca
atggagctgagccggcacaccgacggcttcattgtcggctccgccctcatcaaccgcgtt
gaggccctttgggaggacccggagcggtcgacgacggaccgcctcgatacggtggagggg
tttgcccgccacctcaagtcggggacgccggtccctacccctcaacccaacccggcatga

DBGET integrated database retrieval system