KEGG   Salinibacter ruber M8: SRM_02067Help
Entry
SRM_02067         CDS       T01209                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
srm  Salinibacter ruber M8
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:srm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:srm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2373077..2374504
Genome map
AA seq 475 aa AA seqDB search
MSPLPTNNFTHRRFHPAPFLISHSVQPPSSHQHCCPMDKLVVRGESSLQGPLTVSGSKNT
ALPLMAATLLAKGPSTITNVPDLRDVRTFSKVIRHGGPAVAFDADAHTLSVDATTIETPV
APYELVKKMRASFYMLGALLGRCGTAKVSLPGGCAWGPRPVDLHIEGMKQFGADIELDEG
YVHASTPNGGLAGGTFRLEPVSVGATINLLLAAVTAQGGSKIENAAKEPDVVAFGRALQE
MGAQIDGLGTRTIEVQGVDALNAGTFRNTPDRIELGTFILMAATAAEPGRPVDIHEGTHE
HLGPVFKEKLAETGVDVSYGTEAVTVTRPETLRPVSVETSPFPGFATDLQAQWTVLLSRT
DGTATVTDTIYDDRFKHVPELQRLGMEIEVDGNTATIHGGAPLKGAKVMSTDLRAGVSLV
MAGMLAEGRTDVLRVYHLDRGYEDLEDKLRGAGVSIHREAYDEFAEPDQAPAQDG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcccctgccgacgaacaatttcacgcatcggcgttttcatccggcaccatttttg
atttcacactcggtccagcccccttcctcccaccagcattgctgccccatggataaactc
gtcgtccgcggagagtcgtcgctccaaggcccccttaccgtgagcggatcgaaaaacacg
gcccttccgctcatggccgccacccttctggcgaaaggcccctcgaccatcaccaacgta
ccggacctgcgggacgtgcgcaccttttcgaaggtcattcggcacggggggccggcggtc
gccttcgatgccgacgcccacaccctctcggtggacgcgaccaccattgagacgccggtg
gcgccctacgaactggtcaagaagatgcgggcctccttctacatgctcggcgcgctcctg
gggcgctgcgggacggccaaggtgtccctccccggaggctgcgcgtgggggccccgaccg
gtcgatctgcacattgagggcatgaagcagttcggggccgacattgagttggacgagggc
tacgtgcacgcctccaccccgaatggcgggctcgcgggcggcaccttccggctggagccc
gtgagcgtgggggccaccatcaaccttctgctcgccgccgtgacggcccagggcggctcc
aagatcgagaacgcggccaaggagccggacgtggtggccttcgggcgcgccctgcaggag
atgggggctcagatcgacggcctcggcacccggacgatcgaggtgcagggcgtcgacgcg
ctcaacgcgggcaccttccgcaacacgcccgaccgcatcgagctgggcaccttcatcctc
atggccgcgaccgccgccgagcccggccgccccgtcgacatccacgagggcacccacgag
cacctgggcccggtcttcaaggaaaagctggccgaaacgggggtcgacgtgtcctacggc
accgaagccgtcaccgtcacgcgccccgagacgctccgtccggtttccgtcgagacgtcc
cccttccccggcttcgcgaccgacctgcaggcacagtggaccgtcttgctcagccgcacc
gacggcacggccacagtgacggacacgatctacgacgaccggttcaagcacgtcccggag
ctgcagcgcctcggcatggagatcgaggtggacggaaacacggcgacaatccatgggggc
gcgccgctgaagggggccaaggtcatgagcacggacctgcgggccggcgtttccctcgtg
atggccggcatgctcgccgagggccgcacggacgttctccgcgtctaccacctcgaccgc
gggtacgaagacctcgaagacaagctccgcggcgccggagtctccatccaccgcgaggcg
tacgacgagtttgctgagccggaccaggcccccgctcaggacgggtaa

DBGET integrated database retrieval system