KEGG   Salinibacter ruber M8: SRM_02160Help
Entry
SRM_02160         CDS       T01209                                 

Gene name
pcm
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
srm  Salinibacter ruber M8
Brite
Enzymes [BR:srm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SRM_02160 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2487085..2487777)
Genome map
AA seq 230 aa AA seqDB search
MTATPSDDRKYRHQRERLVETLRERGIHDERVLSAVGAVARHAFVDPALRDRAYADEALP
IGLNQTISQPFTVAYQTALLGVQPDDRILEVGTGSGFQAAVLCEMGARVYSIERHDDLLR
RARSVLDGLGYDVRTRHGDGTRGWPAFAPYDGIVVTAGAPEIPAPLLHQLREPSGEDDGP
GGRLVIPIGGREGQTMTRVRRTGSGPHDYEQEEFHSFRFVPLVDEDEGGG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaccccctcggacgaccggaaataccgccaccaacgcgaacggctcgttgag
acccttcgcgagcggggcatccacgacgagcgggtcctgtcggcggtcggggcggtggcc
cggcatgccttcgtggacccggccctccgcgatcgggcctacgccgacgaggccctcccg
attgggctcaaccagaccatctcccagcccttcacggtggcgtaccagaccgcgttgctg
ggcgtgcagccggacgatcgcatcctggaggtgggcacgggcagtgggtttcaggccgcc
gtgctgtgcgagatgggggcgcgagtctattcgatcgagcgccacgacgacctgctccgg
cgggcccgatccgtgctcgacgggctcggctacgacgtgcgaacgcggcacggggacgga
acgcgggggtggcccgcctttgcgccctacgacgggatcgtggtgaccgcgggggcgccc
gagattcccgctccgcttctccaccagctccgtgagccgtccggggaggacgacggccca
ggggggcggctcgtcattccgattggggggcgtgaggggcagaccatgacgcgcgtccgc
cgtaccggttcgggcccccacgactacgagcaggaggaatttcactcgttccgcttcgtg
cccctggtcgacgaggacgaggggggcggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system