KEGG   Salinibacter ruber M8: SRM_02162Help
Entry
SRM_02162         CDS       T01209                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
srm  Salinibacter ruber M8
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRM_02162 (folP)
Enzymes [BR:srm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SRM_02162 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2488704..2489723)
Genome map
AA seq 339 aa AA seqDB search
MDLVPTALCVYLAPTSVRGSPLLETRPPAPPMPRMSRSTPSLNPDDFPTDRFVLGGDDYT
LDCRPGSPEAAGAHVMGVLNVTPDSFSDGGQYVTVEKALSRAAEMLSEGASIIDVGGEST
RPGADPVSKEDERDRVVPVIDALTDRFPEAVVSVDTYKPDVARASLAAGADIVNDVTGLR
HDPEMAAAAADWKAPLMVMHSMGEPGDLTRPREYDDVTAQVRDALARTVETAEQAGVEQV
IIDPGFGFGKSDAENFRLLNEIDELLTLNCPVLVGVSRKSTIGATLGTPDDPAPVDERLF
GSLGATAAAVARGATIVRTHDIAPTVEMLKVLGVTLRQR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgttccgacagcgctctgtgtataccttgccccaacaagtgttcgtggctct
ccgcttcttgaaacgcgtccccctgctcctccgatgccccgcatgtcgcgctcaaccccg
tcgctgaatcctgacgattttcccaccgatcggttcgtgctcggtggggacgactacacg
ctcgactgccggcccgggagcccggaggctgcgggggctcacgtgatgggagtcctgaac
gtgacccccgactccttttccgacggcggtcagtacgtgaccgtcgagaaggcactgtcg
cgggccgccgagatgttgagtgagggggcctccatcatcgacgtcgggggcgagtcgacc
cggcccggggcggatcccgtctcgaaagaagacgagcgcgaccgggtggtgcccgtcatc
gacgccctcacggatcggttccccgaagcggtggtgtcggtcgacacctacaagcccgac
gtggcccgggcgtccctcgccgcgggggcggacatcgtgaacgacgtcaccggcctgcgg
cacgatcccgagatggccgcggccgcggccgactggaaggcgcccctcatggtcatgcac
tcgatgggcgagcccggcgacctcacgcggccccgcgagtacgacgacgtgacggcccag
gtgcgcgacgcactggcccggacggtggagaccgccgagcaggccggtgtggagcaggtg
atcatcgatccgggcttcggcttcgggaagtccgacgccgaaaacttccgcctgctcaac
gagatcgacgagcttctcaccctcaactgccccgtgctcgtgggcgtctcccgcaagagc
acgatcggggccacgctgggcacgcccgacgaccccgcgcccgtggacgagcggctcttc
gggtcgctcggggcgacggcggcggccgtggcgcggggggccaccatcgtgcgcacccac
gacatcgcccccaccgtcgagatgctcaaggtgctcggggtcaccctccgccaacggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system