KEGG   Salinibacter ruber M8: SRM_02185Help
Entry
SRM_02185         CDS       T01209                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
srm  Salinibacter ruber M8
Pathway
srm00010  Glycolysis / Gluconeogenesis
srm00020  Citrate cycle (TCA cycle)
srm00620  Pyruvate metabolism
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
srm01130  Biosynthesis of antibiotics
srm01200  Carbon metabolism
Module
srm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_02185 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SRM_02185 (pdhC)
   00620 Pyruvate metabolism
    SRM_02185 (pdhC)
Enzymes [BR:srm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SRM_02185 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 TonB_N
Motif
Other DBs
NCBI-ProteinID: CBH25106
UniProt: D5HAQ1
Position
complement(2514868..2516265)
Genome map
AA seq 465 aa AA seqDB search
MAIPIEMPKLSDTMEEGVLSAWLVDEGEEVSAGDVLAQVETDKATMDLEAFDEGVLLKQV
IGEGDAVPIGELIAVIGEAGEDISDLVDDAGGDGAAEPEADPDAEVDPDADAEDASAEPE
VEPEPAPEPSGDGQLSERTPEPVPAGTDAEGRRIKASPLARRIAQEHDVELAQVDGSGPE
GRIVRRDVETHVEKQEAAPESTPEPEPTTEPEPAPQPEPSVPEAPSYAMPDEEAAYESEG
ITQMRETIARRLAESKYSAPHYYLTVDIDVERAIEVREDLNELAEEQGRAKISFNDFITK
ACALSLHDHPYVNAAYRPDEGEIHKHNRVHIGIAVAIDEGLITPVIRDADRKGLSELARE
TRALAERARDRDLEPEEFEGATFTTSNLGMFGIEEFTAIINPPNSAILAIGEIRDTPVVE
DGEVVPGKRMKVTLSCDHRVVDGAKGAHFLDTVKSYLEEPMNLLL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcgattccaattgaaatgcccaagttgagcgataccatggaggagggggtgctttcc
gcctggctcgtggacgagggcgaggaggtgtcggcgggcgacgtgctggcccaggtggaa
acggacaaggctacgatggacctggaggccttcgacgagggggtgctgctcaaacaagtg
atcggagagggggacgccgtgcccatcggggagctgatcgccgtgattggggaggccggg
gaggacatctccgacctcgtggatgacgccggcggggacggggccgcggagcccgaggcc
gatccggacgccgaggtcgatccggacgccgatgcggaggacgcatcagccgagccggag
gtggagcccgagcccgcgccggagccgagcggggacgggcagttgtccgaacggacgccg
gagccggtgcccgccgggaccgacgcggaggggcgccgcatcaaggcgtctcctctggcc
cgccgcattgcgcaggagcacgacgtggaactggcgcaggtcgacggatccgggcccgag
gggcgcatcgtgcgtcgggacgtggaaacccatgtcgagaagcaggaggccgcgcccgaa
tcgacgcccgaaccggagccgacaactgaaccggagccggcgccccagcccgagccgtcc
gtcccggaggcgccgtcctacgcgatgccggacgaggaggccgcgtacgagtccgaaggc
atcacgcagatgcgggagaccatcgcccggcgcctcgcggagagcaagtactcggccccg
cactactacctgacggtcgacatcgacgtggagcgcgcgatcgaggtgcgcgaggacctc
aacgagctggcggaggagcagggccgcgcgaaaatctccttcaacgacttcatcaccaag
gcgtgcgccctctcgctgcacgaccacccgtacgtcaacgccgcctaccgccccgacgag
ggcgaaatccacaagcacaaccgcgtgcacatcggcattgccgtcgccatcgacgagggg
ctgatcacccccgtcattcgcgacgcggaccggaaggggctctcggagctcgcccgcgag
acgcgggccctggccgagcgggcccgcgaccgcgacctggagccggaggagtttgaaggg
gcgaccttcaccacgagcaacctcggcatgttcggcatcgaggagttcacggccatcatc
aacccgcccaactcggccatcctggcgatcggcgaaatccgcgacacgcccgtcgtggag
gacggcgaggtggtgccggggaagcgcatgaaggtgaccctctcctgcgaccaccgcgtc
gtggatggggccaagggggcccacttcctcgacacggtgaagtcctacctggaggaaccc
atgaacctgttgctgtag

DBGET integrated database retrieval system