KEGG   Salinibacter ruber M8: SRM_02533Help
Entry
SRM_02533         CDS       T01209                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
srm  Salinibacter ruber M8
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SRM_02533 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_02533 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SRM_02533 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SRM_02533 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SRM_02533 (adh)
   00626 Naphthalene degradation
    SRM_02533 (adh)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SRM_02533 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2948524..2949762
Genome map
AA seq 412 aa AA seqDB search
MNELSFLYVPFFPDVTAPQSPLSIRGGSSPWIPCLETRPESIGTGLRTFRVPSRTTPPEG
AVRFACTTAPSALMSTMQAARIPSAGADFEIVDLPVPDPDAHEVRVRVEACGICHSDAFV
KEGTFPGLEYPRVPGHEVAGVVDAVGTDVTQWSEGDRVGVGWHGGHCFTCDACRTGDFVN
CENGLVTGIHYDGGYAEYMTAPAEAVAKMPEALAAEDAAPLLCAGITTFNALRNQDLQPG
DLVAVQGIGGLGHLGVQYAAAMGLEVVALSTSADKEELAHDLGASHFVDVSSTDPAEALQ
HQGGADLILATAPNADAITSVVGGLGRDGDLVIVAATGEAVEVPPMALIQGRKSVSGWPS
GDAKDSEDTLAFSAQAEALPEIETFSLEEAGAAYDRMINNEARFRAVLTMDH
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagctctcatttctctacgtgcctttcttcccagacgttacagcaccgcagtcc
cctttgtcaatccggggtgggtcctcgccgtggattccctgcctggaaacgcggccggag
tcgatcggtaccggtctacggacttttcgggttccttccagaacgactcctccggaggga
gccgttcgattcgcctgcacaacagccccttctgccctcatgtccaccatgcaagccgcc
cgcattcccagtgccggggccgactttgaaatcgttgaccttcctgtgcccgaccccgac
gcccacgaggtgcgcgttcgcgtcgaggcgtgtggcatctgtcacagcgacgccttcgtg
aaggagggcacgttccccggcctcgaataccctcgcgtgccggggcacgaggtcgccggg
gtggtcgacgccgtgggaacggatgtcacccagtggtcggagggcgaccgcgtgggggtc
ggctggcacggcggccactgcttcacctgcgacgcctgtcgcacgggcgactttgtgaac
tgcgagaacggcctcgtgaccggcatccactacgacggcggctacgccgagtacatgacc
gcccccgccgaggccgtggcgaagatgccggaggccctggccgccgaagacgccgcgccc
ctgctctgcgccggcatcaccacgttcaacgcgcttcgcaatcaggacctgcagcccggc
gacctcgtcgcggtgcagggcatcggcggactgggccacctgggcgtgcagtacgccgcg
gcgatgggcctggaggtggtggcgctctccacgagtgccgacaaggaagaactggcccac
gacctcggggcctcccacttcgttgacgtctcgagcaccgacccggccgaggcgctccag
caccagggcggggccgacctcatcctggccaccgccccaaacgccgacgccatcacgtcg
gtcgtcggcgggctgggccgcgacggggacctcgtgatcgtcgccgcgacgggagaggcg
gtcgaggtcccgccgatggcgctcattcagggccgcaagtcggtctccggctggcccagc
ggcgacgcgaaggactcggaggacacgctcgcgttcagcgcgcaggccgaggcgctgccc
gagattgagaccttctctctagaggaggccggggccgcctacgaccgcatgatcaacaat
gaggcccgcttccgcgcggtcctcacgatggaccattag

DBGET integrated database retrieval system