KEGG   Salinibacter ruber M8: SRM_02545Help
Entry
SRM_02545         CDS       T01209                                 

Gene name
chlI
Definition
Magnesium-chelatase subunit chlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
srm  Salinibacter ruber M8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:srm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2967959..2969659)
Genome map
AA seq 566 aa AA seqDB search
MANRPPLVTGSGRNSGSARRVRGTAEGLLRCHSRLILVAVPPTNRRSSMALTDRTTLGEL
KEADYQVRSVKDELRANLMQKLRAGEEVFPGILGYDETVIPRIQNAILAKHDLILLGLRG
QAKSRLIRMLPRLLDDHIPVIEDTPLNEDPFNPITKQGRAIVEERGDDTPIEWLPREARY
GEKLATPDTTIADLIGDIDPIKAANERLTYADEEVIHFGIVPRTNRGIFAINELPDLQPR
IQVGLFNIMEEQDIQIRGFNVRFPLDVMMVFSANPEDYTSRGNLVTPLKDRIDSQITTHY
PKTIETGMSITEQEAWQDRADGAAAVDVHIPQFFREIVEQVAFEARESEYIDQTSGVSVR
VTRAALEALISAAERRALLNGEDETTVRVSDLMHVAPAITGKVELVYEGEQEGAEEVALT
LIGRAVRALFDEYFPDPSDKEEGRPEYKDVLDWFAQGRSIDLDQDMSDAAYAETLGQIDG
LQALAEEYLSPDTTGETHTGMEFVVESLHQHSLVGKEISDGGQTYDDIMGSMLSSIGDGG
VPGDDFDEGDFDDDDDDTDDPLSRYR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaccgcccgccactcgttacaggatcgggcaggaattcggggtctgcccggcgc
gtgagaggaacagcggaggggctgttgcggtgccattctcgcttgattttggttgctgtt
ccccccacgaaccgccgctcctccatggcccttaccgaccgcacgacgcttggcgaactg
aaagaggccgactatcaggtccgctccgtgaaggacgaactgcgggccaatctgatgcag
aagctccgtgccggcgaggaggtctttcccggcattctgggctacgacgagaccgtcatt
ccgcggattcagaatgccatcctcgcgaagcacgacctcatcctgctggggctgcgcggg
caggccaagagccgcctcatccgcatgctgccgcggctcctcgacgaccacattccggtg
atcgaggacacacccctcaacgaggatcccttcaatccgatcaccaagcaggggcgcgca
atcgtggaggagcggggcgacgacacgccgatcgagtggctgccccgggaggcgcgctac
ggcgagaagctggcgacgccggacaccacgatcgccgacctcatcggcgacatcgacccc
atcaaggccgccaacgagcggctcacctacgccgacgaggaggttatccacttcggcatc
gtgccgcgcaccaaccgcggcattttcgccatcaacgagctgccggacctccagccgcga
attcaggtgggtctcttcaacatcatggaggagcaggacatccagatccgcggcttcaac
gtgcggtttccgctcgacgtgatgatggtcttctccgccaacccggaggactacaccagc
cgcggcaacctcgtgacgccgctcaaggaccgcatcgacagccaaatcacgacccattac
ccgaagacgatcgagacgggcatgtccattaccgagcaggaggcgtggcaggaccgcgcc
gacggggcggcggcggtggacgtgcacatcccgcagttcttccgcgaaatcgtcgagcag
gtggcgttcgaggcgcgcgagagcgagtacattgaccagacctccggggtctcggtccgt
gtgacgcgggcggcgctggaggcgctcatctccgcggccgagcggcgggcgcttctcaac
ggcgaggacgagacgaccgtccgcgtcagcgacctgatgcacgtggccccggccatcacc
ggcaaggtggaactcgtctacgagggggagcaagagggtgccgaagaggtggcgctcacg
ctgatcgggcgggccgtccgggcgctcttcgacgagtacttccccgacccgagcgacaag
gaagagggccgtcccgagtacaaggacgtgctcgactggtttgcccagggccgctccatc
gacctggaccaggacatgagcgacgcggcgtacgcggagacgctcgggcagatcgacggc
ctccaggcgctcgcggaggagtacctctcgccggacacgaccggcgagacccacacgggc
atggagttcgtcgtggagtcgctccaccagcactcgctcgtgggcaaagagattagcgac
ggcgggcagacctacgacgacatcatgggttcgatgctctcctccatcggcgacggcggc
gtgccgggcgatgacttcgacgagggcgacttcgacgacgatgacgacgacaccgacgac
ccgttgagtcggtaccggtag

DBGET integrated database retrieval system