KEGG   Salinibacter ruber M8: SRM_02597Help
Entry
SRM_02597         CDS       T01209                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
srm  Salinibacter ruber M8
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SRM_02597 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRM_02597 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SRM_02597 (thrC)
Enzymes [BR:srm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SRM_02597 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3033534..3034874)
Genome map
AA seq 446 aa AA seqDB search
MRFPAVQYLSTRTPAHRVSLSTALQDGLAPDGGLYVPERFPTLGPEAFAGCTTIEAVAER
LLRPFAEGDGLADVLPGICEAMFGFPVPLREIGRGTSVLELFHGPTAAFKDVGARFLADS
LARLNEGAAQPLTILVATSGDTGAAVAAAFWKKPNVEVVVLYPKGKVSDRQEQQLTGWSD
NVQTVAVRGVFDDCQTLVKEAFQDEAWQERLRLSSANSINIGRLLPQMTYYAYASLRHWR
AHGTRPNVIVPSGNLGNGLACLYARECGLPIGEVVFATNENRPVTHYLGTGEYEAFETQE
TLATAMDVGNPSNMERLRYHYSGSGGAEALHDAIGAERVTDEQIERHVRQGPEDWDTVWD
PHTATAVEAREHLDPDDEHEWILVATAHPAKFPEVVEPLVGHAVDVPEPLAEVMARSHPV
PEVDPTLSAVADVVFEDRRRDATEHA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctttcctgccgtgcagtatttgagcacccgcacccccgcccatcgcgtttccctc
tccacggcgctgcaggacggactggcgccggacggggggctgtacgtgcccgaacggttt
ccgaccctcgggcccgaggcgtttgcgggatgcaccacgatcgaggcggtggcggagcgg
cttctgcgcccgtttgcggagggggacggcctggcggacgtgctgccggggatctgcgag
gcgatgtttggctttccggtgccgctgcgcgagatcggccgggggacgagcgtcctcgaa
ctcttccacggccccacggcggcgtttaaggacgtgggggcgcgcttcctggccgacagc
cttgcccgtctcaacgaaggggccgcgcagccgcttaccatcctcgtggccacctccggc
gacaccggcgcggccgtggcggcggccttctggaagaagcccaacgtcgaggtcgtcgtc
ctctacccgaagggcaaggtgtccgaccggcaggagcagcagctcaccgggtggagcgac
aacgtgcagaccgtggccgtccgcggcgtgtttgacgactgccagacgctcgtgaaggag
gcctttcaggacgaggcgtggcaggagcgcctgcgcctctcctccgccaacagcatcaac
atcgggcgtctgctgccgcagatgacgtactacgcctacgccagcctccggcactggcgc
gcccacggcacccgccccaacgtgatcgtgccgtccggcaacctgggcaacgggctcgcc
tgcctgtacgcccgcgagtgcgggctgccgattggggaagtcgtcttcgcgacgaacgag
aaccgacccgtcacgcactacctgggaaccggcgagtacgaggcgtttgagacgcaggaa
accctggcgacggcgatggacgtgggcaatcccagcaacatggagcgcctgcgctaccac
tattccggcagcggtggagcggaggcactgcacgatgccatcggcgccgagcgcgtcacc
gacgagcagatcgaacggcacgtccgccaggggcccgaggactgggacacggtgtgggac
ccccacacggccaccgcggtcgaggcccgcgagcatctcgatcccgacgacgagcacgag
tggatcctggtggccaccgcgcacccggccaagtttccggaggtggtggagccgctcgtg
gggcacgcggtcgacgtgcccgaaccactggccgaggtgatggcgcggtcgcatcccgtc
cccgaggtggacccgacgctctcggcggtggcggacgtggtgttcgaggaccgcaggcgc
gacgcgacggagcacgcgtag

DBGET integrated database retrieval system