KEGG   Salinibacter ruber M8: SRM_02706Help
Entry
SRM_02706         CDS       T01209                                 

Gene name
frvX
Definition
(GenBank) endoglucanase, putative
Organism
srm  Salinibacter ruber M8
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3175696..3176766)
Genome map
AA seq 356 aa AA seqDB search
MTDDAKSFFFDLLDTPSPTGFEAPGQRVWTEYVRDHADAVEADAYGTAWARLEGTADDAP
SVMLDAHADEIGFMVRHITDDGFIHINRIGGSDRAIARGLRVRILGDDGPVTGVVGNTAI
HIRDTKNEKVPKVHELFVDIGAEDEEEVHDRGIRVGHPMVFDVGPTELTDTRITARAIDN
RLGGFILAQAVARLAEERPAWQVQAANSVQEEIGGHGAKMITHRLDPDAAIAFDVTHATD
SPGISSTKHGDVELGAGPTVTHGTSNHPQLVERVIEVADAEDIPLQHEPSSRRTGTDTDS
IFKTRSGVPSVLLSVPLRYMHSTVEVADTEDIEHCVQLYAALVRSFGADEEFSVSL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgcgaaatcgttcttcttcgatcttctggacaccccgagccccaccggc
tttgaggcgcccgggcagcgcgtgtggaccgagtacgtgcgcgaccacgccgacgcggtg
gaggccgacgcgtacggcacggcctgggcccgcctggagggcacggccgacgatgccccg
agcgtcatgctcgacgcgcacgccgacgagatcgggttcatggtgcgccacatcaccgac
gacggcttcatccacatcaaccgcatcggcggctccgaccgcgccatcgcgcgggggctg
cgtgtgcgcatcctcggggacgacgggccggtcaccggcgtggtgggcaacacggccatc
cacatccgcgacaccaagaacgaaaaggtgcccaaggtgcacgagctgttcgtggacatc
ggggccgaggacgaggaggaggtgcacgaccgcggcatccgggtgggccacccgatggtg
ttcgacgtgggcccgaccgagctgaccgacacccgcatcaccgcccgcgccatcgacaac
cgactcggcggcttcatcctcgcgcaggccgtggcgcggctggcggaggagcgcccggcg
tggcaggtgcaggcggccaactcggtgcaggaagaaatcggagggcacggggcgaagatg
atcacgcaccgcctcgatccggacgccgcgatcgcgttcgacgtgacccacgccaccgac
tcgccgggcatcagcagcaccaagcacggcgacgttgagctcggggcggggccgaccgtg
acgcacggcacgtccaaccacccgcagctcgtggagcgcgtcatcgaggttgccgacgcc
gaggacattccgctccagcacgagccgagcagccgccgcaccggcaccgacaccgactcc
atcttcaagacccgcagcggcgtgcccagtgtgcttctgtccgtgccgctccgctacatg
cactcgaccgtcgaggtggccgacaccgaagacatcgagcactgcgtgcagctctacgcg
gcgctcgtgcgttccttcggggcggacgaggagtttagcgtctcgctgtag

DBGET integrated database retrieval system