KEGG   Salinibacter ruber M8: SRM_02706Help
Entry
SRM_02706         CDS       T01209                                 

Gene name
frvX
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
srm  Salinibacter ruber M8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SRM_02706 (frvX)
Enzymes [BR:srm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SRM_02706 (frvX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3175696..3176766)
Genome map
AA seq 356 aa AA seqDB search
MTDDAKSFFFDLLDTPSPTGFEAPGQRVWTEYVRDHADAVEADAYGTAWARLEGTADDAP
SVMLDAHADEIGFMVRHITDDGFIHINRIGGSDRAIARGLRVRILGDDGPVTGVVGNTAI
HIRDTKNEKVPKVHELFVDIGAEDEEEVHDRGIRVGHPMVFDVGPTELTDTRITARAIDN
RLGGFILAQAVARLAEERPAWQVQAANSVQEEIGGHGAKMITHRLDPDAAIAFDVTHATD
SPGISSTKHGDVELGAGPTVTHGTSNHPQLVERVIEVADAEDIPLQHEPSSRRTGTDTDS
IFKTRSGVPSVLLSVPLRYMHSTVEVADTEDIEHCVQLYAALVRSFGADEEFSVSL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgcgaaatcgttcttcttcgatcttctggacaccccgagccccaccggc
tttgaggcgcccgggcagcgcgtgtggaccgagtacgtgcgcgaccacgccgacgcggtg
gaggccgacgcgtacggcacggcctgggcccgcctggagggcacggccgacgatgccccg
agcgtcatgctcgacgcgcacgccgacgagatcgggttcatggtgcgccacatcaccgac
gacggcttcatccacatcaaccgcatcggcggctccgaccgcgccatcgcgcgggggctg
cgtgtgcgcatcctcggggacgacgggccggtcaccggcgtggtgggcaacacggccatc
cacatccgcgacaccaagaacgaaaaggtgcccaaggtgcacgagctgttcgtggacatc
ggggccgaggacgaggaggaggtgcacgaccgcggcatccgggtgggccacccgatggtg
ttcgacgtgggcccgaccgagctgaccgacacccgcatcaccgcccgcgccatcgacaac
cgactcggcggcttcatcctcgcgcaggccgtggcgcggctggcggaggagcgcccggcg
tggcaggtgcaggcggccaactcggtgcaggaagaaatcggagggcacggggcgaagatg
atcacgcaccgcctcgatccggacgccgcgatcgcgttcgacgtgacccacgccaccgac
tcgccgggcatcagcagcaccaagcacggcgacgttgagctcggggcggggccgaccgtg
acgcacggcacgtccaaccacccgcagctcgtggagcgcgtcatcgaggttgccgacgcc
gaggacattccgctccagcacgagccgagcagccgccgcaccggcaccgacaccgactcc
atcttcaagacccgcagcggcgtgcccagtgtgcttctgtccgtgccgctccgctacatg
cactcgaccgtcgaggtggccgacaccgaagacatcgagcactgcgtgcagctctacgcg
gcgctcgtgcgttccttcggggcggacgaggagtttagcgtctcgctgtag

DBGET integrated database retrieval system