KEGG   Salinibacter ruber M8: SRM_02774Help
Entry
SRM_02774         CDS       T01209                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
srm  Salinibacter ruber M8
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:srm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SRM_02774 (recR)
DNA repair and recombination proteins [BR:srm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SRM_02774 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3262683..3263396)
Genome map
AA seq 237 aa AA seqDB search
MQYTSESVETLVEQFTKLPTIGKKTARRLANYVLKMPQEEVETIANALTSVKEDVQRCST
CYVVADQDPCPICGSDKRDASTICVVEESSDLTAIEQTNEYRGVYHVLGGVISPLDGVGP
DDLRVHELATRIDPSFEDTAADAAPEPNTTPDGEADAEAPPSENGGADEAESGVDEVILA
VNPNVEGDTTAYYISQLLEPFDVRVTRIARGLPIGGDLEYADEATLSRALEGRGHVD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacacctcggagtccgtcgaaaccctcgtggagcagttcacgaagctgcccacg
atcgggaagaagacggcgcggcgactggccaactacgtcctgaagatgccccaggaggag
gttgagaccatcgcgaacgcgttgacgtccgtgaaggaggacgtgcaacgctgttcgacg
tgctacgtcgtggcggatcaggatccgtgccccatctgcggctcggacaagcgcgacgcc
tcgacgatttgtgtcgtggaggagtcgagcgacctgaccgccatcgagcagaccaacgag
taccggggcgtgtaccacgtgctcggcggggtcatttcgccgctcgacggcgtgggcccc
gacgacctccgggtgcacgagctggccacccgcatcgacccgtccttcgaagacacggcg
gccgatgcggctccggagcccaacaccacgcctgatggcgaagcggacgccgaggcgcct
ccctcggaaaatggcggggcggacgaggcggaatcgggggtcgacgaggtgattctcgcc
gtcaaccccaacgtcgagggcgacacgacggcatactacatctcccagcttcttgagccg
ttcgacgttcgcgtcacgcgcatcgcgcggggactgcccatcggcggggatctggagtac
gccgacgaggcgaccctctcgcgggcgctggagggacgcgggcacgtcgactag

DBGET integrated database retrieval system