KEGG   Salinibacter ruber M8: SRM_02821Help
Entry
SRM_02821         CDS       T01209                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase of group 1 operon
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
srm  Salinibacter ruber M8
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:srm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:srm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3314723..3315823)
Genome map
AA seq 366 aa AA seqDB search
MIRVLVVDDSLVMRKAISRIFEQADDTTVVDTATNGEAGVEKARRLEPDVVTMDVEMPKM
NGIEAVRHIMEASPRPILMLSSLTEKGAEVTMEAMQAGAADFLSKGASSATLRANDVEEK
LLGKVRALADSNARLFREDGPSPAETASSTGSREASSSSSPTSSGTDTATKGSYELAVIG
VSTGGPMALQHVIPALPAAFPLPIAIVQHMPAQFTRSLADRLDSLSELAVAEAEDGMLLE
PGRVVVAAGDRHLTVERREGALTTCTPAEPAGDSHRPSVNVLFRSAVEACREDVLTLVMT
GMGKDGLEGARRIQDDGGTVYVQDEDTSVVYGMPRAVAEAGLADATFPLDDLPDAMQKAA
GAPARP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatccgagtgctcgtcgttgatgattcgttggtgatgcggaaggccatctcgcggatc
ttcgagcaggccgacgatacgaccgtcgtggacacggccacaaacggcgaggccggggtc
gaaaaggcgcgtcgactggagcccgacgtggtgacgatggacgtcgagatgccgaagatg
aatggcatcgaggccgtccgccacatcatggaggcgtccccccgtcccatcctcatgctg
agctccctcacggagaagggggccgaggtgacgatggaggcgatgcaggcgggcgcggcc
gactttctgtcgaagggggcgtccagcgccaccctccgggccaacgacgtcgaggaaaaa
ctgctcggcaaggtgcgagccctcgcagattcgaacgcgcggctgttccgagaggacggg
ccttcccccgccgagacggcgtcgtcgacgggctcccgggaggcatcgtcctcctcttcc
cccacgtcgtccggcaccgacaccgcgacgaagggctcctacgagttggccgtcatcggc
gtgtccacgggcgggccgatggccctccagcacgtcatcccggccctgcccgccgcgttt
ccgctgccgatcgcgattgtgcagcacatgccggcccagttcacgcgctcgctggccgat
cgcctcgattcactcagcgaacttgcggtggccgaggccgaagacgggatgctgctcgag
ccgggacgggtcgtcgtcgcggcgggggatcgccaccttacggtggagcgacgcgagggc
gccctcacgacctgcacgccggcggagccggcgggcgactcccatcggccatcggtgaac
gtcctctttcggtccgccgtcgaagcgtgccgggaagacgtgctaaccctcgtcatgacg
ggcatggggaaggatgggctggagggggcccggcgcatccaagacgatggggggaccgtt
tacgtccaggacgaggacacctccgtggtctacgggatgccgcgtgccgttgcggaggcg
ggactcgcggacgcgacgtttccgctcgatgacctgcccgatgcgatgcagaaggccgcg
ggggccccggcccgcccgtag

DBGET integrated database retrieval system